F184264

General Info

Members Datasets Scaffolds Average Seq Length
141 110 123 514

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8046991243|8046993371
Length 583
Sequence EKTRIGIIFKNEAARAVLIRRLPDLASSPPHMLSLFKSLTLEKVYAFRQEELGQPDWIADTLAELAGVASDSGVAEPDADVEVARSADYEPADVPEASAAVQAPAEAEQWGIYEIELKGPSHGNPFTDVELAAEFKFGGKSVRMAGFYDGDGVYRIRFMPDAQGDWTYRTASSARSLNGIEGAFRVVPPSAGNHGPVRVKDTYHFAYEDGTSYIPVGTTCYAWTHQGEELEAQTLETLKASPFNKMRMCVFPKSYLFNENEPVYDPFEGSLAQGWDYTRFNPVFFRHLEDRIADLGKLGIEADLILFHAYDRWGYSEMSPAADDRYLRYITARLSAYRNVWWSLANEYDLMWNKEPADWERFAEIVTTNDPAGHLISNHNCFAFYDYSKPWVTHCSIQRVDVYKTSEATTEWRERWKKPIVIDECAYEGDIDQGWGNITGEEMTRRFWEGAIRGGYVGHGETYLNPEEVLWWSKGGKLTGTSPDRISFLRRIVEESPGGVLNPLPSDWDVPCAGEKDEYYLYYFGFNQPRFRNFSRKPGTKYNVDVIDTWNMTVERLEGTYEGAFRIELPGRQFMAVRMSKAE

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
3 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
4 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
5 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
6 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
7 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
8 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
9 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
10 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
11 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
12 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
13 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
38 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
39 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
45 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
46 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
47 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
48 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
49 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
50 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
51 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
52 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
53 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
54 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
60 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
78 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
79 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
89 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
90 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
91 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
92 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
107 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
108 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
109 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
110 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.23
Metatranscriptomes 0
Isolates 12.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 1.42
Rhizoplane 0.71
Rhizosphere 74.47
Stem 0
Stem Tuber 0
Unclassified 18.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000762 3300002773 Bacteria 16249
2 Ga0070683_100000036 3300005329 Bacteria 121734
3 Ga0070713_100186773 3300005436 Unclassified 1865
4 Ga0070681_10068342 3300005458 Bacteria 3520
5 Ga0070698_100144497 3300005471 Bacteria 2329
6 Ga0070679_100067451 3300005530 Bacteria 3568
7 Ga0070684_100000025 3300005535 Bacteria 122054
8 Ga0068855_100005698 3300005563 Bacteria 15216
9 Ga0081539_10030783 3300005985 Bacteria 3324
10 Ga0070717_10006742 3300006028 Bacteria 8473
11 Ga0075366_10017428 3300006195 Bacteria 4133
12 Ga0105240_10001509 3300009093 Bacteria 39619
13 Ga0105240_10044140 3300009093 Bacteria 5667
14 Ga0105240_10064015 3300009093 Bacteria 4571
15 Ga0105237_10010501 3300009545 Bacteria 9839
16 Ga0105237_10099263 3300009545 Bacteria 2903
17 Ga0105238_10041732 3300009551 Bacteria 4647
18 Ga0157374_10033605 3300013296 Bacteria 4681
19 Ga0209566_100160 3300025225 Bacteria 75483
20 Ga0207684_10002124 3300025910 Bacteria 20325
21 Ga0207695_10005600 3300025913 Bacteria 16588
22 Ga0207695_10024735 3300025913 Bacteria 6743
23 Ga0207671_10003619 3300025914 Bacteria 15268
24 Ga0207646_10006112 3300025922 Bacteria 12538
25 Ga0207661_10000048 3300025944 Bacteria 94661
26 Ga0265338_10000198 3300028800 Bacteria 113584
27 Ga0265338_10000463 3300028800 Bacteria 72298
28 Ga0265338_10001683 3300028800 Bacteria 35130
29 Ga0265320_10000344 3300031240 Bacteria 37824
30 Ga0265329_10012136 3300031242 Bacteria 3108
31 Ga0265327_10000037 3300031251 Bacteria 293502
32 Ga0265316_10002791 3300031344 Bacteria 17906
33 Ga0265316_10007041 3300031344 Bacteria 10656
34 Ga0307508_10000069 3300031616 Bacteria 119428
35 Ga0265342_10029079 3300031712 Bacteria 3435
36 Ga0307405_10045157 3300031731 Bacteria 2698
37 Ga0316577_10105023 3300031733 Bacteria 1584
38 Ga0307414_10060685 3300032004 Bacteria 2675
39 Ga0373930_0000204 3300034816 Bacteria 7303
40 Ga0373950_0003471 3300034818 Bacteria 2251
41 Ga0373928_0000091 3300035084 Bacteria 15907
42 Ga0373944_0000231 3300035089 Bacteria 12125
43 Ga0373949_0002336 3300035090 Bacteria 4924
44 Ga0373932_0000003 3300035112 Bacteria 459351
45 Ga0373939_0000107 3300035114 Bacteria 25390
46 Ga0373962_0000048 3300035242 Bacteria 27954
47 Ga0373931_0000011 3300035691 Bacteria 304643
48 Ga0373931_0003311 3300035691 Bacteria 7216
49 Ga0373927_0002057 3300035695 Bacteria 14845
50 Ga0373937_0227662 3300036401 Bacteria 1755
51 Ga0316582_0004438 3300036647 Bacteria 7095
52 Ga0316582_0039193 3300036647 Bacteria 2949
53 Ga0316584_0049341 3300036712 Bacteria 3146
54 Ga0373925_0000527 3300037068 Bacteria 37900
55 Ga0400489_28921 3300039093 Bacteria 4475
56 Ga0400489_73697 3300039093 Unclassified 2044
57 Ga0451851_0271077 3300041507 Bacteria 2865
58 Ga0451853_0014326 3300041512 Bacteria 1843
59 Ga0439449_0003659 3300042007 Bacteria 5966
60 Ga0439462_0016303 3300042015 Bacteria 1919
61 Ga0451577_0000012 3300042876 Bacteria 575467
62 Ga0451577_0005350 3300042876 Bacteria 13179
63 Ga0451577_0016115 3300042876 Bacteria 6930
64 Ga0453684_0004962 3300044712 Bacteria 27080
65 Ga0453684_0017061 3300044712 Bacteria 11272
66 Ga0453684_0040487 3300044712 Bacteria 6326
67 Ga0451576_0152057 3300045051 Bacteria 2414
68 Ga0495603_0000313 3300046455 Bacteria 26009
69 Ga0495629_0001009 3300046459 Bacteria 22600
70 Ga0495651_0012497 3300046462 Bacteria 6548
71 Ga0495653_0054696 3300046463 Bacteria 3049
72 Ga0495580_0010891 3300046472 Bacteria 7058
73 Ga0495662_0002024 3300046476 Bacteria 10143
74 Ga0495618_0039357 3300046514 Unclassified 2972
75 Ga0495628_0142805 3300046516 Bacteria 1826
76 Ga0495652_0005917 3300046529 Bacteria 11442
77 Ga0495645_0000613 3300046543 Bacteria 24639
78 Ga0495667_0004303 3300046559 Bacteria 9602
79 Ga0495667_0052184 3300046559 Bacteria 2695
80 Ga0495623_0069493 3300046679 Bacteria 2195
81 Ga0495646_0029180 3300046680 Bacteria 3450
82 Ga0495613_0004578 3300046689 Bacteria 10375
83 Ga0495613_0008621 3300046689 Bacteria 7567
84 Ga0495613_0021002 3300046689 Bacteria 4867
85 Ga0495604_0066811 3300047317 Bacteria 2734
86 Ga0495674_0052718 3300047319 Bacteria 3578
87 Ga0495674_0089422 3300047319 Unclassified 2632
88 Ga0495676_0000683 3300047321 Bacteria 28275
89 Ga0495675_0008383 3300047444 Bacteria 6399
90 Ga0495684_0062712 3300047471 Bacteria 2827
91 Ga0495684_0081678 3300047471 Unclassified 2452
92 Ga0495684_0169733 3300047471 Bacteria 1623
93 Ga0495686_0001766 3300047472 Bacteria 22119
94 Ga0495614_0000116 3300048089 Bacteria 27456
95 Ga0496116_0005247 3300048919 Bacteria 12109
96 Ga0496116_0032733 3300048919 Bacteria 3700
97 Ga0496117_0000252 3300048920 Bacteria 101322
98 Ga0496118_0029314 3300048921 Bacteria 4618
99 Ga0496119_0000749 3300048922 Bacteria 43650
100 Ga0496120_0000704 3300048923 Bacteria 49025
101 Ga0496120_0014242 3300048923 Bacteria 5309
102 Ga0496122_0004631 3300048925 Bacteria 16920
103 Ga0496122_0014478 3300048925 Bacteria 7619
104 Ga0496123_0002182 3300048926 Bacteria 24933
105 Ga0496124_0000422 3300048927 Bacteria 75716
106 Ga0496124_0089166 3300048927 Bacteria 2519
107 Ga0496125_0000265 3300048928 Bacteria 107587
108 Ga0496125_0001220 3300048928 Bacteria 38582
109 Ga0496126_0000096 3300048929 Bacteria 206730
110 Ga0496126_0003425 3300048929 Bacteria 20016
111 Ga0501032_0028450 3300049569 Bacteria 3840
112 Ga0501034_0000105 3300049571 Bacteria 154973
113 Ga0501034_0217107 3300049571 Bacteria 1866
114 Ga0501038_0165622 3300049574 Bacteria 1793
115 Ga0501043_0121245 3300049579 Bacteria 2051
116 Ga0501080_0289226 3300049742 Bacteria 1488
117 Ga0501083_0003047 3300049744 Bacteria 11650
118 Ga0501083_0029961 3300049744 Bacteria 3739
119 Ga0501044_0040182 3300049823 Bacteria 4876
120 Ga0500644_0029293 3300053088 Bacteria 1730
121 Ga0500641_0000007 3300053096 Bacteria 206510
122 Ga0500641_0000548 3300053096 Bacteria 13524
123 Ga0500568_0006696 3300053139 Bacteria 5759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0165622 Ga0501038_0165622_243_1598 414
2 3300047471 Ga0495684_0169733 Ga0495684_0169733_274_1605 422
3 3300048921 Ga0496118_0029314 Ga0496118_0029314_3173_4564 423
4 3300034816 Ga0373930_0000204 Ga0373930_0000204_5834_7288 439
5 3300046463 Ga0495653_0054696 Ga0495653_0054696_133_1488 451
6 3300046529 Ga0495652_0005917 Ga0495652_0005917_2732_4087 451
7 3300046680 Ga0495646_0029180 Ga0495646_0029180_613_1968 451
8 3300047319 Ga0495674_0089422 Ga0495674_0089422_466_1821 451
9 3300046455 Ga0495603_0000313 Ga0495603_0000313_14517_15938 455
10 3300046459 Ga0495629_0001009 Ga0495629_0001009_11703_13124 455
11 3300046689 Ga0495613_0004578 Ga0495613_0004578_7626_9047 455
12 3300047321 Ga0495676_0000683 Ga0495676_0000683_175_1596 455
13 3300048089 Ga0495614_0000116 Ga0495614_0000116_16559_17980 455
14 3300006028 Ga0070717_10006742 Ga0070717_100067424 458
15 3300036647 Ga0316582_0039193 Ga0316582_0039193_213_1619 461
16 3300005471 Ga0070698_100144497 Ga0070698_1001444972 463
17 3300041507 Ga0451851_0271077 Ga0451851_0271077_301_2040 463
18 3300041512 Ga0451853_0014326 Ga0451853_0014326_79_1599 463
19 3300049742 Ga0501080_0289226 Ga0501080_0289226_13_1470 465
20 3300053088 Ga0500644_0029293 Ga0500644_0029293_23_1453 465
21 3300035695 Ga0373927_0002057 Ga0373927_0002057_2889_4340 470
22 3300006195 Ga0075366_10017428 Ga0075366_100174285 471
23 3300036401 Ga0373937_0227662 Ga0373937_0227662_230_1717 474
24 3300047472 Ga0495686_0001766 Ga0495686_0001766_15337_16860 474
25 3300005329 Ga0070683_100000036 Ga0070683_10000003634 475
26 3300005535 Ga0070684_100000025 Ga0070684_10000002547 475
27 3300025944 Ga0207661_10000048 Ga0207661_1000004832 475
28 3300005458 Ga0070681_10068342 Ga0070681_100683422 476
29 3300005530 Ga0070679_100067451 Ga0070679_1000674513 476
30 3300005563 Ga0068855_100005698 Ga0068855_1000056984 476
31 3300009093 Ga0105240_10001509 Ga0105240_1000150936 476
32 3300025913 Ga0207695_10005600 Ga0207695_100056002 476
33 3300031242 Ga0265329_10012136 Ga0265329_100121362 476
34 3300031344 Ga0265316_10002791 Ga0265316_1000279112 476
35 3300031344 Ga0265316_10007041 Ga0265316_100070415 476
36 3300031712 Ga0265342_10029079 Ga0265342_100290792 476
37 3300031733 Ga0316577_10105023 Ga0316577_101050231 476
38 3300036647 Ga0316582_0004438 Ga0316582_0004438_5390_6859 476
39 3300036712 Ga0316584_0049341 Ga0316584_0049341_755_2185 476
40 3300039093 Ga0400489_73697 Ga0400489_73697_74_1528 476
41 3300046462 Ga0495651_0012497 Ga0495651_0012497_314_1852 476
42 3300046472 Ga0495580_0010891 Ga0495580_0010891_1480_2985 476
43 3300046476 Ga0495662_0002024 Ga0495662_0002024_7576_9060 476
44 3300046516 Ga0495628_0142805 Ga0495628_0142805_24_1508 476
45 3300046543 Ga0495645_0000613 Ga0495645_0000613_5911_7395 476
46 3300046559 Ga0495667_0004303 Ga0495667_0004303_365_1903 476
47 3300046559 Ga0495667_0052184 Ga0495667_0052184_698_2203 476
48 3300046679 Ga0495623_0069493 Ga0495623_0069493_62_1567 476
49 3300046689 Ga0495613_0021002 Ga0495613_0021002_1335_2873 476
50 3300047317 Ga0495604_0066811 Ga0495604_0066811_821_2305 476
51 3300047319 Ga0495674_0052718 Ga0495674_0052718_60_1550 476
52 3300047444 Ga0495675_0008383 Ga0495675_0008383_2948_4438 476
53 3300047471 Ga0495684_0062712 Ga0495684_0062712_1267_2757 476
54 3300047471 Ga0495684_0081678 Ga0495684_0081678_284_1822 476
55 iso_pu_bacteria 2600255229 2601446097 476
56 iso_pu_bacteria 2938649242 2938650102 476
57 iso_pu_bacteria 2968558590 2968563848 476
58 3300009093 Ga0105240_10044140 Ga0105240_100441401 477
59 3300009093 Ga0105240_10064015 Ga0105240_100640151 477
60 3300009545 Ga0105237_10010501 Ga0105237_100105016 477
61 3300009545 Ga0105237_10099263 Ga0105237_100992632 477
62 3300009551 Ga0105238_10041732 Ga0105238_100417323 477
63 3300013296 Ga0157374_10033605 Ga0157374_100336053 477
64 3300025225 Ga0209566_100160 Ga0209566_1001608 477
65 3300025913 Ga0207695_10024735 Ga0207695_100247354 477
66 3300025914 Ga0207671_10003619 Ga0207671_100036196 477
67 3300042007 Ga0439449_0003659 Ga0439449_0003659_1808_3283 477
68 3300042015 Ga0439462_0016303 Ga0439462_0016303_184_1659 477
69 iso_pu_bacteria 2585428059 2587742207 477
70 iso_pu_bacteria 2643221676 2644428301 477
71 iso_pu_bacteria 8054795415 8054798582 477
72 iso_pu_bacteria 8054795415 8054802588 477
73 3300039093 Ga0400489_28921 Ga0400489_28921_2419_3975 478
74 3300042876 Ga0451577_0000012 Ga0451577_0000012_264047_265654 478
75 3300044712 Ga0453684_0004962 Ga0453684_0004962_12409_13860 478
76 3300048919 Ga0496116_0005247 Ga0496116_0005247_10016_11707 478
77 3300048925 Ga0496122_0004631 Ga0496122_0004631_5741_7483 478
78 3300048927 Ga0496124_0000422 Ga0496124_0000422_60150_61772 478
79 3300048927 Ga0496124_0089166 Ga0496124_0089166_30_1721 478
80 3300048928 Ga0496125_0001220 Ga0496125_0001220_10026_11648 478
81 3300049744 Ga0501083_0029961 Ga0501083_0029961_1325_2926 478
82 iso_pu_bacteria 2600255286 2601637922 478
83 iso_pu_bacteria 2791355222 2793186344 478
84 iso_pu_bacteria 2954002825 2954004972 478
85 iso_pu_bacteria 2988225383 2988225553 478
86 iso_pu_bacteria 8002317523 8002324181 478
87 iso_pu_bacteria 8046991243 8046993371 478
88 3300005985 Ga0081539_10030783 Ga0081539_100307832 479
89 3300028800 Ga0265338_10000198 Ga0265338_1000019813 479
90 3300028800 Ga0265338_10000463 Ga0265338_1000046345 479
91 3300028800 Ga0265338_10001683 Ga0265338_1000168319 479
92 3300031240 Ga0265320_10000344 Ga0265320_1000034431 479
93 3300031251 Ga0265327_10000037 Ga0265327_1000003793 479
94 3300031616 Ga0307508_10000069 Ga0307508_1000006974 479
95 3300034818 Ga0373950_0003471 Ga0373950_0003471_296_1945 479
96 3300035084 Ga0373928_0000091 Ga0373928_0000091_14235_15884 479
97 3300035089 Ga0373944_0000231 Ga0373944_0000231_5031_6680 479
98 3300035090 Ga0373949_0002336 Ga0373949_0002336_1211_2860 479
99 3300035112 Ga0373932_0000003 Ga0373932_0000003_385059_386708 479
100 3300035114 Ga0373939_0000107 Ga0373939_0000107_811_2409 479
101 3300035242 Ga0373962_0000048 Ga0373962_0000048_6239_7888 479
102 3300035691 Ga0373931_0000011 Ga0373931_0000011_61055_62704 479
103 3300035691 Ga0373931_0003311 Ga0373931_0003311_2148_3746 479
104 3300037068 Ga0373925_0000527 Ga0373925_0000527_20946_22595 479
105 3300042876 Ga0451577_0005350 Ga0451577_0005350_554_2200 479
106 3300042876 Ga0451577_0016115 Ga0451577_0016115_453_2129 479
107 3300044712 Ga0453684_0017061 Ga0453684_0017061_3633_5309 479
108 3300044712 Ga0453684_0040487 Ga0453684_0040487_3904_5514 479
109 3300045051 Ga0451576_0152057 Ga0451576_0152057_229_1887 479
110 3300046514 Ga0495618_0039357 Ga0495618_0039357_1280_2851 479
111 3300046689 Ga0495613_0008621 Ga0495613_0008621_5732_7303 479
112 3300048919 Ga0496116_0032733 Ga0496116_0032733_2034_3581 479
113 3300048929 Ga0496126_0003425 Ga0496126_0003425_12342_13835 479
114 3300049569 Ga0501032_0028450 Ga0501032_0028450_771_2474 479
115 3300049571 Ga0501034_0000105 Ga0501034_0000105_119340_120998 479
116 3300049579 Ga0501043_0121245 Ga0501043_0121245_44_1705 479
117 3300049744 Ga0501083_0003047 Ga0501083_0003047_6591_8192 479
118 3300053139 Ga0500568_0006696 Ga0500568_0006696_3332_4975 479
119 iso_pu_bacteria 2585428059 2587739627 479
120 3300005436 Ga0070713_100186773 Ga0070713_1001867732 480
121 3300025910 Ga0207684_10002124 Ga0207684_100021243 480
122 3300025922 Ga0207646_10006112 Ga0207646_100061123 480
123 3300032004 Ga0307414_10060685 Ga0307414_100606852 480
124 3300048920 Ga0496117_0000252 Ga0496117_0000252_87378_88949 480
125 3300048922 Ga0496119_0000749 Ga0496119_0000749_20075_21646 480
126 3300048923 Ga0496120_0000704 Ga0496120_0000704_21688_23259 480
127 3300048923 Ga0496120_0014242 Ga0496120_0014242_3552_5108 480
128 3300048925 Ga0496122_0014478 Ga0496122_0014478_3626_5179 480
129 3300048926 Ga0496123_0002182 Ga0496123_0002182_19755_21308 480
130 3300048928 Ga0496125_0000265 Ga0496125_0000265_3626_5179 480
131 3300048929 Ga0496126_0000096 Ga0496126_0000096_80818_82389 480
132 3300049571 Ga0501034_0217107 Ga0501034_0217107_211_1725 480
133 3300049823 Ga0501044_0040182 Ga0501044_0040182_3213_4727 480
134 3300053096 Ga0500641_0000007 Ga0500641_0000007_122296_123816 480
135 3300053096 Ga0500641_0000548 Ga0500641_0000548_6146_7666 480
136 iso_pu_bacteria 2513020052 2513232112 480
137 iso_pu_bacteria 2643221667 2644371284 480
138 iso_pu_bacteria 2929150217 2929153791 480
139 iso_pu_bacteria 2582581304 2585258931 502
140 3300002773 JGI25152J39213_1000762 JGI25152J39213_10007627 506
141 3300031731 Ga0307405_10045157 Ga0307405_100451572 506

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18310

DUF5605

Domain of unknown function (DUF5605)

508

580

0.99

PF16586

DUF5060

Domain of unknown function (DUF5060)

106

173

0.97

PF13204

DUF4038

Protein of unknown function (DUF4038)

199

479

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n0r-assembly1.cif.gz_B crystal structure of a putative glycoside hydrolase (bvu_0362) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.8859 3 506
4n0r-assembly1.cif.gz_B crystal structure of a putative glycoside hydrolase (bvu_0362) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.8808 3 506
7o0b-assembly1.cif.gz_A trim3 filamin domain 0.7681 4 86
2dj4-assembly1.cif.gz_A solution structure of the 13th filamin domain from human filamin-b 0.7422 4 89
4b7l-assembly1.cif.gz_A crystal structure of human filamin b actin binding domain with 1st filamin repeat 0.7409 2 84
ID Description Score Start End Superfamily
4n0rB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9424 3 88 2.60.40.10
4n0rA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9338 96 390 3.20.20.80
4n0rB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9316 3 88 2.60.40.10
4n0rA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9065 96 390 3.20.20.80
af_F8VPT3_74_267_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.771 175 279 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A383F0N4-F1-model_v4 DUF5060 domain-containing protein 0.9962 3 96
AF-A0A4Q3XVS8-F1-model_v4 DUF5060 domain-containing protein 0.9942 3 283
AF-X1NWQ3-F1-model_v4 Apiosidase-like catalytic domain-containing protein 0.992 184 364
AF-A0A4Q3XVS8-F1-model_v4 DUF5060 domain-containing protein 0.9907 3 283
AF-A0A3D2Z004-F1-model_v4 DUF5060 domain-containing protein 0.9896 3 354

Feature Viewer

pLDDT pTM Quality
90.78 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map