F183520

General Info

Members Datasets Scaffolds Average Seq Length
141 95 282 152

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0176670|Ga0466958_0176670_324_821
Length 165
Sequence VSSSSADAPAVESRDSVLPPGTSVPEFTLRREDGSAFGRADLEGQTTVLVFYPFAFSPVCTDQLSVYQEVLPEFEQRGATLYGVSCDATWSQKAFRERLGVAIEQLSDFEPKGEACRAFGVYHPGGFAQRALVTVGPDVKVKWSYQAPSPAELPGANLIFDGLAA

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
14 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
15 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
16 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
19 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
27 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
28 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
29 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
30 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
31 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
32 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
33 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
34 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
35 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
36 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
37 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
38 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
39 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
40 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
41 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
58 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
59 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
62 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
69 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
70 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
71 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
75 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
76 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
92 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.35
Rhizosphere 78.01
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0176670 3300045836 Bacteria 1354
2 JGI25406J46586_10218798 3300003203 Bacteria 557
3 Ga0070709_10588265 3300005434 Bacteria 855
4 Ga0070714_100093788 3300005435 Bacteria 2633
5 Ga0070714_100278968 3300005435 Unclassified 1552
6 Ga0070710_10019687 3300005437 Bacteria 3491
7 Ga0068852_101750122 3300005616 Bacteria 644
8 Ga0081539_10019873 3300005985 Bacteria 4574
9 Ga0070717_10571480 3300006028 Bacteria 1024
10 Ga0070712_100000004 3300006175 Bacteria 215464
11 Ga0070712_100063140 3300006175 Bacteria 2621
12 Ga0070712_101265083 3300006175 Bacteria 642
13 Ga0099795_10439268 3300007788 Bacteria 599
14 Ga0105240_10837295 3300009093 Bacteria 994
15 Ga0114129_10909250 3300009147 Bacteria 1115
16 Ga0105242_10230394 3300009176 Bacteria 1660
17 Ga0163163_11850577 3300014325 Bacteria 664
18 Ga0213873_10011390 3300021358 Bacteria 1902
19 Ga0213874_10000359 3300021377 Bacteria 9040
20 Ga0213876_10013997 3300021384 Bacteria 4252
21 Ga0213876_10022533 3300021384 Bacteria 3329
22 Ga0213875_10000080 3300021388 Bacteria 114342
23 Ga0224712_10284627 3300022467 Bacteria 770
24 Ga0207692_10039888 3300025898 Bacteria 2313
25 Ga0207693_10000017 3300025915 Bacteria 139308
26 Ga0207693_10008897 3300025915 Bacteria 8203
27 Ga0207663_10016283 3300025916 Bacteria 4119
28 Ga0207700_11512922 3300025928 Bacteria 595
29 Ga0207664_10088411 3300025929 Bacteria 2535
30 Ga0207664_10993226 3300025929 Bacteria 752
31 Ga0207665_10056295 3300025939 Bacteria 2654
32 Ga0265338_10486107 3300028800 Bacteria 871
33 Ga0265324_10085102 3300029957 Bacteria 1076
34 Ga0373954_0070483 3300035118 Bacteria 1661
35 Ga0373957_0046683 3300035120 Bacteria 1645
36 Ga0373955_0061948 3300035172 Bacteria 2068
37 Ga0373924_0191436 3300035410 Bacteria 901
38 Ga0373933_0628714 3300035724 Bacteria 705
39 Ga0373937_0009583 3300036401 Bacteria 8429
40 Ga0436364_0140777 3300037853 Bacteria 47350
41 Ga0436364_0183585 3300037853 Unclassified 572
42 Ga0436364_0204291 3300037853 Bacteria 1128
43 Ga0436364_0320605 3300037853 Bacteria 2778
44 Ga0436364_0593994 3300037853 Bacteria 686
45 Ga0395901_0798821 3300038443 Bacteria 933
46 Ga0436365_0849630 3300039437 Bacteria 2014
47 Ga0436365_0920074 3300039437 Bacteria 17041
48 Ga0436363_0570740 3300039450 Bacteria 876
49 Ga0436363_0751201 3300039450 Bacteria 34304
50 Ga0436363_1004448 3300039450 Bacteria 1160
51 Ga0436362_0459433 3300039453 Bacteria 4125
52 Ga0451789_0093728 3300041443 Bacteria 758
53 Ga0451833_0890121 3300041491 Bacteria 1016
54 Ga0466972_0125419 3300044658 Bacteria 1210
55 Ga0466965_0188437 3300044683 Bacteria 1090
56 Ga0466965_0220957 3300044683 Bacteria 1010
57 Ga0466966_0051177 3300044684 Bacteria 2626
58 Ga0466966_0112804 3300044684 Bacteria 1675
59 Ga0466966_0224045 3300044684 Bacteria 1135
60 Ga0466961_0287741 3300044693 Bacteria 1005
61 Ga0466963_0013974 3300044694 Bacteria 4944
62 Ga0466963_0278789 3300044694 Bacteria 1175
63 Ga0466963_0556592 3300044694 Bacteria 810
64 Ga0466971_0073277 3300044719 Bacteria 1556
65 Ga0466968_0041085 3300044735 Bacteria 1951
66 Ga0466968_0048067 3300044735 Bacteria 1815
67 Ga0466968_0226498 3300044735 Bacteria 882
68 Ga0466970_0040534 3300044765 Bacteria 2473
69 Ga0466970_0068697 3300044765 Bacteria 1904
70 Ga0466970_0193840 3300044765 Bacteria 1130
71 Ga0466957_0028693 3300044842 Bacteria 3314
72 Ga0466957_0039513 3300044842 Bacteria 2847
73 Ga0466957_0191278 3300044842 Bacteria 1341
74 Ga0466960_0851903 3300044901 Bacteria 554
75 Ga0466959_0111267 3300045049 Bacteria 1954
76 Ga0466959_0192048 3300045049 Bacteria 1425
77 Ga0466958_0000815 3300045836 Bacteria 13769
78 Ga0466958_0086282 3300045836 Bacteria 1937
79 Ga0466958_0229707 3300045836 Bacteria 1185
80 Ga0466958_0287416 3300045836 Bacteria 1054
81 Ga0466958_0463034 3300045836 Bacteria 821
82 Ga0466958_0849341 3300045836 Bacteria 595
83 Ga0466958_0874492 3300045836 Bacteria 586
84 Ga0466967_0026126 3300045976 Bacteria 4830
85 Ga0466967_0600876 3300045976 Bacteria 1086
86 Ga0466967_1332154 3300045976 Bacteria 715
87 Ga0495592_0018115 3300046454 Bacteria 5351
88 Ga0495603_0515074 3300046455 Bacteria 685
89 Ga0495651_0007698 3300046462 Bacteria 8238
90 Ga0495653_0008291 3300046463 Bacteria 8521
91 Ga0495662_0515190 3300046476 Bacteria 586
92 Ga0495608_0003131 3300046511 Bacteria 11815
93 Ga0495618_0035769 3300046514 Bacteria 3118
94 Ga0495628_0003835 3300046516 Bacteria 13403
95 Ga0495663_0155411 3300046525 Bacteria 783
96 Ga0495665_0097360 3300046531 Bacteria 1545
97 Ga0495640_0027163 3300046533 Bacteria 4131
98 Ga0495586_0242540 3300046535 Bacteria 1027
99 Ga0495645_0166487 3300046543 Bacteria 1520
100 Ga0495667_0006715 3300046559 Bacteria 7810
101 Ga0495634_0189922 3300046642 Bacteria 1282
102 Ga0495635_0024764 3300046663 Bacteria 4182
103 Ga0495635_0305086 3300046663 Bacteria 1067
104 Ga0495657_0013817 3300046675 Bacteria 5943
105 Ga0495623_0324158 3300046679 Bacteria 845
106 Ga0495646_0014904 3300046680 Bacteria 4938
107 Ga0495613_0174686 3300046689 Bacteria 1523
108 Ga0495600_0027988 3300046809 Bacteria 3645
109 Ga0495581_0232235 3300047315 Bacteria 1079
110 Ga0495604_0048790 3300047317 Bacteria 3292
111 Ga0495674_0028213 3300047319 Bacteria 5123
112 Ga0495674_0079066 3300047319 Bacteria 2825
113 Ga0495672_0064612 3300047320 Bacteria 2095
114 Ga0495680_0006571 3300047322 Bacteria 10789
115 Ga0495593_0165159 3300047673 Bacteria 1117
116 Ga0495602_0021983 3300048088 Bacteria 6254
117 Ga0495602_0203397 3300048088 Bacteria 1509
118 Ga0496104_0069059 3300048907 Bacteria 3358
119 Ga0496105_0373016 3300048908 Bacteria 1136
120 Ga0496108_0294449 3300048911 Bacteria 1413
121 Ga0496109_0042681 3300048912 Bacteria 4109
122 Ga0496109_0220580 3300048912 Bacteria 1783
123 Ga0496110_0435335 3300048913 Bacteria 1195
124 Ga0496110_0518780 3300048913 Bacteria 1084
125 Ga0496111_0133236 3300048914 Bacteria 1840
126 Ga0496111_0621418 3300048914 Bacteria 790
127 Ga0496112_0069600 3300048915 Bacteria 3476
128 Ga0496112_1140545 3300048915 Bacteria 697
129 Ga0496113_0073747 3300048916 Bacteria 2601
130 Ga0496114_0023642 3300048917 Bacteria 5016
131 Ga0496115_0000222 3300048918 Bacteria 52327
132 Ga0496115_0082602 3300048918 Bacteria 2618
133 Ga0501067_0198706 3300049583 Bacteria 1117
134 Ga0495612_0052383 3300053078 Bacteria 1679
135 Ga0495619_0103578 3300053085 Bacteria 1939
136 Ga0495619_0282822 3300053085 Bacteria 1149
137 Ga0495619_0926877 3300053085 Bacteria 585
138 Ga0495619_0978240 3300053085 Bacteria 567
139 Ga0501084_1029849 3300054114 Bacteria 692
140 Ga0466962_0035841 3300061719 Bacteria 2374
141 Ga0466962_0158380 3300061719 Bacteria 1100
142 Ga0466958_0176670
143 JGI25406J46586_10218798
144 Ga0070709_10588265
145 Ga0070714_100093788
146 Ga0070714_100278968
147 Ga0070710_10019687
148 Ga0068852_101750122
149 Ga0081539_10019873
150 Ga0070717_10571480
151 Ga0070712_100000004
152 Ga0070712_100063140
153 Ga0070712_101265083
154 Ga0099795_10439268
155 Ga0105240_10837295
156 Ga0114129_10909250
157 Ga0105242_10230394
158 Ga0163163_11850577
159 Ga0213873_10011390
160 Ga0213874_10000359
161 Ga0213876_10013997
162 Ga0213876_10022533
163 Ga0213875_10000080
164 Ga0224712_10284627
165 Ga0207692_10039888
166 Ga0207693_10000017
167 Ga0207693_10008897
168 Ga0207663_10016283
169 Ga0207700_11512922
170 Ga0207664_10088411
171 Ga0207664_10993226
172 Ga0207665_10056295
173 Ga0265338_10486107
174 Ga0265324_10085102
175 Ga0373954_0070483
176 Ga0373957_0046683
177 Ga0373955_0061948
178 Ga0373924_0191436
179 Ga0373933_0628714
180 Ga0373937_0009583
181 Ga0436364_0140777
182 Ga0436364_0183585
183 Ga0436364_0204291
184 Ga0436364_0320605
185 Ga0436364_0593994
186 Ga0395901_0798821
187 Ga0436365_0849630
188 Ga0436365_0920074
189 Ga0436363_0570740
190 Ga0436363_0751201
191 Ga0436363_1004448
192 Ga0436362_0459433
193 Ga0451789_0093728
194 Ga0451833_0890121
195 Ga0466972_0125419
196 Ga0466965_0188437
197 Ga0466965_0220957
198 Ga0466966_0051177
199 Ga0466966_0112804
200 Ga0466966_0224045
201 Ga0466961_0287741
202 Ga0466963_0013974
203 Ga0466963_0278789
204 Ga0466963_0556592
205 Ga0466971_0073277
206 Ga0466968_0041085
207 Ga0466968_0048067
208 Ga0466968_0226498
209 Ga0466970_0040534
210 Ga0466970_0068697
211 Ga0466970_0193840
212 Ga0466957_0028693
213 Ga0466957_0039513
214 Ga0466957_0191278
215 Ga0466960_0851903
216 Ga0466959_0111267
217 Ga0466959_0192048
218 Ga0466958_0000815
219 Ga0466958_0086282
220 Ga0466958_0229707
221 Ga0466958_0287416
222 Ga0466958_0463034
223 Ga0466958_0849341
224 Ga0466958_0874492
225 Ga0466967_0026126
226 Ga0466967_0600876
227 Ga0466967_1332154
228 Ga0495592_0018115
229 Ga0495603_0515074
230 Ga0495651_0007698
231 Ga0495653_0008291
232 Ga0495662_0515190
233 Ga0495608_0003131
234 Ga0495618_0035769
235 Ga0495628_0003835
236 Ga0495663_0155411
237 Ga0495665_0097360
238 Ga0495640_0027163
239 Ga0495586_0242540
240 Ga0495645_0166487
241 Ga0495667_0006715
242 Ga0495634_0189922
243 Ga0495635_0024764
244 Ga0495635_0305086
245 Ga0495657_0013817
246 Ga0495623_0324158
247 Ga0495646_0014904
248 Ga0495613_0174686
249 Ga0495600_0027988
250 Ga0495581_0232235
251 Ga0495604_0048790
252 Ga0495674_0028213
253 Ga0495674_0079066
254 Ga0495672_0064612
255 Ga0495680_0006571
256 Ga0495593_0165159
257 Ga0495602_0021983
258 Ga0495602_0203397
259 Ga0496104_0069059
260 Ga0496105_0373016
261 Ga0496108_0294449
262 Ga0496109_0042681
263 Ga0496109_0220580
264 Ga0496110_0435335
265 Ga0496110_0518780
266 Ga0496111_0133236
267 Ga0496111_0621418
268 Ga0496112_0069600
269 Ga0496112_1140545
270 Ga0496113_0073747
271 Ga0496114_0023642
272 Ga0496115_0000222
273 Ga0496115_0082602
274 Ga0501067_0198706
275 Ga0495612_0052383
276 Ga0495619_0103578
277 Ga0495619_0282822
278 Ga0495619_0926877
279 Ga0495619_0978240
280 Ga0501084_1029849
281 Ga0466962_0035841
282 Ga0466962_0158380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

20

144

0.97

PF08534

Redoxin

Redoxin

19

158

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.8861 3 140
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8755 3 140
2wfc-assembly1.cif.gz_D crystal structure of peroxiredoxin 5 from arenicola marina 0.8701 4 140
6krk-assembly1.cif.gz_B peroxiredoxin from aeropyrum pernix k1 (apprx) 0cys mutant 0.8698 2 124
7c87-assembly1.cif.gz_B peroxiredoxin from aeropyrum pernix k1 (apprx) c50s/f80c/c207s/c213s mutant (apprx*f80c) 0.8686 2 124
ID Description Score Start End Superfamily
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8782 2 140 3.40.30.10
af_Q960M4_24_190_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8739 1 138 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8624 5 140 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8565 2 138 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8554 2 140 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W0A7D4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9415 3 140 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A538A886-F1-model_v4 Redoxin domain-containing protein 0.9409 3 141 GO:0016209
GO:0016491
AF-A0A2W5YSI4-F1-model_v4 Alkyl hydroperoxide reductase 0.9384 1 142 GO:0016209
GO:0016491
AF-A0A2W5YSI4-F1-model_v4 Alkyl hydroperoxide reductase 0.9321 1 142 GO:0016209
GO:0016491
AF-A0A0D4BYM3-F1-model_v4 Thioredoxin domain-containing protein 0.9238 1 141 GO:0016209
GO:0016491

Map