F182821

General Info

Members Datasets Scaffolds Average Seq Length
141 107 282 140

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10906574|Ga0207646_109065742
Length 160
Sequence VILRPALLGISQEGLYFFGMRALALDVGQKTIGLAMTDEALIAAHPLTVLQRVGNFGDAAAIAALVAEHRVTDLVVGMPYELSGKLGHRARRVQGFIAALRAALPPEVQFHEQDERFTTAQAERVLIEGDVSRARRRSVIDQQAAALILQGWLDAQRARG

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
69 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
70 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
98 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
99 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
100 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
101 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
102 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
103 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
104 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
105 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 2.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.51
Nodule 0
Rhizoplane 0
Rhizosphere 84.4
Stem 0
Stem Tuber 0
Unclassified 31.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10906574 3300025922 Unclassified 782
2 Ga0070690_100201508 3300005330 Bacteria 1385
3 Ga0068869_100397700 3300005334 Unclassified 1132
4 Ga0070689_100372637 3300005340 Bacteria 1202
5 Ga0070691_10000307 3300005341 Bacteria 17176
6 Ga0070668_100838289 3300005347 Bacteria 819
7 Ga0070688_101002044 3300005365 Bacteria 664
8 Ga0070714_100001318 3300005435 Bacteria 17935
9 Ga0070714_100083066 3300005435 Bacteria 2792
10 Ga0070714_100294599 3300005435 Bacteria 1511
11 Ga0070701_10095820 3300005438 Bacteria 1635
12 Ga0070700_101500271 3300005441 Bacteria 573
13 Ga0070694_100120064 3300005444 Bacteria 1885
14 Ga0068867_100293148 3300005459 Bacteria 1338
15 Ga0070679_100119005 3300005530 Unclassified 2626
16 Ga0070684_100237638 3300005535 Bacteria 1664
17 Ga0070684_100886964 3300005535 Unclassified 835
18 Ga0070695_101488697 3300005545 Unclassified 563
19 Ga0068855_100029081 3300005563 Bacteria 6609
20 Ga0068855_100059541 3300005563 Bacteria 4468
21 Ga0068857_100950931 3300005577 Unclassified 825
22 Ga0068854_100000023 3300005578 Bacteria 127086
23 Ga0068856_100041967 3300005614 Bacteria 4498
24 Ga0068856_101338590 3300005614 Bacteria 731
25 Ga0068859_101795730 3300005617 Unclassified 677
26 Ga0068863_100484343 3300005841 Unclassified 1217
27 Ga0068858_100455781 3300005842 Bacteria 1233
28 Ga0068860_100438027 3300005843 Unclassified 1298
29 Ga0068862_101870863 3300005844 Unclassified 610
30 Ga0081455_10089985 3300005937 Bacteria 2489
31 Ga0070717_10108768 3300006028 Bacteria 2362
32 Ga0070717_10150620 3300006028 Bacteria 2012
33 Ga0070717_10247236 3300006028 Bacteria 1574
34 Ga0105240_10111114 3300009093 Bacteria 3316
35 Ga0105240_10277652 3300009093 Unclassified 1926
36 Ga0105242_10096715 3300009176 Bacteria 2495
37 Ga0105238_10427115 3300009551 Unclassified 1320
38 Ga0105249_10102516 3300009553 Bacteria 2694
39 Ga0157369_10368954 3300013105 Unclassified 1490
40 Ga0157369_11567051 3300013105 Unclassified 670
41 Ga0157374_10100916 3300013296 Bacteria 2767
42 Ga0157376_10767942 3300014969 Bacteria 974
43 Ga0197907_10047509 3300020069 Unclassified 1144
44 Ga0206356_11693456 3300020070 Bacteria 11590
45 Ga0213873_10005459 3300021358 Bacteria 2441
46 Ga0213872_10021237 3300021361 Bacteria 2989
47 Ga0213874_10220722 3300021377 Unclassified 689
48 Ga0213875_10000001 3300021388 Bacteria 2793540
49 Ga0213871_10104005 3300021441 Unclassified 834
50 Ga0213871_10205185 3300021441 Unclassified 616
51 Ga0207643_10201404 3300025908 Bacteria 1212
52 Ga0207695_10137294 3300025913 Unclassified 2397
53 Ga0207660_10725385 3300025917 Unclassified 811
54 Ga0207662_10107414 3300025918 Bacteria 1736
55 Ga0207662_10329740 3300025918 Bacteria 1021
56 Ga0207649_10892334 3300025920 Unclassified 697
57 Ga0207652_10313459 3300025921 Unclassified 1416
58 Ga0207652_10889096 3300025921 Bacteria 787
59 Ga0207694_10304425 3300025924 Unclassified 1313
60 Ga0207664_10013180 3300025929 Bacteria 5923
61 Ga0207670_10097794 3300025936 Bacteria 2090
62 Ga0207670_10432508 3300025936 Unclassified 1058
63 Ga0207689_10151138 3300025942 Unclassified 1914
64 Ga0207689_10204704 3300025942 Unclassified 1630
65 Ga0207667_10000101 3300025949 Bacteria 137935
66 Ga0207667_10002608 3300025949 Bacteria 22349
67 Ga0207712_10079355 3300025961 Bacteria 2384
68 Ga0207640_10000459 3300025981 Bacteria 24875
69 Ga0207678_10058463 3300026067 Bacteria 3318
70 Ga0207708_10154025 3300026075 Bacteria 1812
71 Ga0207708_11268107 3300026075 Bacteria 645
72 Ga0207702_10026224 3300026078 Bacteria 4838
73 Ga0207641_11055385 3300026088 Unclassified 810
74 Ga0207648_10799176 3300026089 Unclassified 878
75 Ga0268264_10344210 3300028381 Unclassified 1417
76 Ga0265338_10386526 3300028800 Bacteria 1000
77 Ga0265760_10000639 3300031090 Bacteria 9923
78 Ga0307514_10437883 3300031649 Bacteria 649
79 Ga0307516_10054387 3300031730 Bacteria 3912
80 Ga0307406_10050718 3300031901 Bacteria 2632
81 Ga0307412_10959954 3300031911 Bacteria 753
82 Ga0307415_100144359 3300032126 Bacteria 1822
83 Ga0373936_0000001 3300035113 Bacteria 456155
84 Ga0373941_0003134 3300035115 Bacteria 3714
85 Ga0373960_0356293 3300035121 Unclassified 556
86 Ga0373961_0000001 3300035241 Bacteria 199721
87 Ga0373935_0052817 3300035692 Bacteria 2585
88 Ga0395899_0131251 3300037312 Bacteria 1788
89 Ga0395900_0032004 3300037418 Bacteria 5406
90 Ga0395898_0085710 3300037466 Bacteria 3036
91 Ga0395905_1096241 3300037471 Unclassified 699
92 Ga0436364_0273345 3300037853 Bacteria 2794207
93 Ga0395901_0032523 3300038443 Bacteria 5381
94 Ga0395901_1058745 3300038443 Unclassified 784
95 Ga0436365_0730574 3300039437 Unclassified 818
96 Ga0436365_1532545 3300039437 Bacteria 2592
97 Ga0436360_0097301 3300039438 Bacteria 1721
98 Ga0436360_0173106 3300039438 Bacteria 1653
99 Ga0436360_1002092 3300039438 Unclassified 1483
100 Ga0436360_1044118 3300039438 Bacteria 2620
101 Ga0436360_1063004 3300039438 Bacteria 3646
102 Ga0436360_1296053 3300039438 Unclassified 1044
103 Ga0436361_0654078 3300039447 Bacteria 4290
104 Ga0436361_0686581 3300039447 Bacteria 65096
105 Ga0436361_1084917 3300039447 Unclassified 2215
106 Ga0436363_1208593 3300039450 Unclassified 881
107 Ga0436363_1707220 3300039450 Bacteria 4567
108 Ga0436362_0064962 3300039453 Bacteria 4123
109 Ga0436362_0164319 3300039453 Unclassified 532
110 Ga0436362_0398004 3300039453 Unclassified 1221
111 Ga0466966_0047511 3300044684 Bacteria 2736
112 Ga0466966_0205075 3300044684 Unclassified 1192
113 Ga0466963_0014309 3300044694 Bacteria 4889
114 Ga0466964_0317471 3300044706 Unclassified 790
115 Ga0466957_0325288 3300044842 Bacteria 1038
116 Ga0466957_0407518 3300044842 Unclassified 931
117 Ga0466959_0242989 3300045049 Bacteria 1243
118 Ga0466958_0060521 3300045836 Bacteria 2305
119 Ga0466958_0206729 3300045836 Unclassified 1250
120 Ga0466967_0014090 3300045976 Bacteria 6211
121 Ga0466967_0430011 3300045976 Unclassified 1288
122 Ga0466967_0988164 3300045976 Unclassified 838
123 Ga0495659_0359897 3300046664 Bacteria 623
124 Ga0495649_0148663 3300046694 Bacteria 1231
125 Ga0495686_0017690 3300047472 Bacteria 4797
126 Ga0496126_1232912 3300048929 Bacteria 548
127 Ga0501070_0837805 3300049586 Bacteria 720
128 nmdc:mga03683_663328_c1 3300050489 Bacteria 514
129 nmdc:mga0n895_1360787_c1 3300050512 Bacteria 679
130 nmdc:mga0n895_1489170_c1 3300050512 Bacteria 643
131 Ga0500647_0360371 3300053091 Bacteria 602
132 Ga0500566_0095309 3300053094 Bacteria 1639
133 Ga0500640_000856 3300053095 Bacteria 8419
134 Ga0500554_000228 3300053102 Bacteria 12037
135 Ga0500572_005360 3300053111 Bacteria 2902
136 Ga0500595_000273 3300053119 Bacteria 34052
137 Ga0500597_049449 3300053120 Bacteria 1788
138 Ga0500614_001594 3300053123 Bacteria 5348
139 Ga0500642_0015102 3300053130 Bacteria 2892
140 Ga0500559_0007088 3300053136 Bacteria 5001
141 Ga0500564_123967 3300053138 Bacteria 1123
142 Ga0207646_10906574
143 Ga0070690_100201508
144 Ga0068869_100397700
145 Ga0070689_100372637
146 Ga0070691_10000307
147 Ga0070668_100838289
148 Ga0070688_101002044
149 Ga0070714_100001318
150 Ga0070714_100083066
151 Ga0070714_100294599
152 Ga0070701_10095820
153 Ga0070700_101500271
154 Ga0070694_100120064
155 Ga0068867_100293148
156 Ga0070679_100119005
157 Ga0070684_100237638
158 Ga0070684_100886964
159 Ga0070695_101488697
160 Ga0068855_100029081
161 Ga0068855_100059541
162 Ga0068857_100950931
163 Ga0068854_100000023
164 Ga0068856_100041967
165 Ga0068856_101338590
166 Ga0068859_101795730
167 Ga0068863_100484343
168 Ga0068858_100455781
169 Ga0068860_100438027
170 Ga0068862_101870863
171 Ga0081455_10089985
172 Ga0070717_10108768
173 Ga0070717_10150620
174 Ga0070717_10247236
175 Ga0105240_10111114
176 Ga0105240_10277652
177 Ga0105242_10096715
178 Ga0105238_10427115
179 Ga0105249_10102516
180 Ga0157369_10368954
181 Ga0157369_11567051
182 Ga0157374_10100916
183 Ga0157376_10767942
184 Ga0197907_10047509
185 Ga0206356_11693456
186 Ga0213873_10005459
187 Ga0213872_10021237
188 Ga0213874_10220722
189 Ga0213875_10000001
190 Ga0213871_10104005
191 Ga0213871_10205185
192 Ga0207643_10201404
193 Ga0207695_10137294
194 Ga0207660_10725385
195 Ga0207662_10107414
196 Ga0207662_10329740
197 Ga0207649_10892334
198 Ga0207652_10313459
199 Ga0207652_10889096
200 Ga0207694_10304425
201 Ga0207664_10013180
202 Ga0207670_10097794
203 Ga0207670_10432508
204 Ga0207689_10151138
205 Ga0207689_10204704
206 Ga0207667_10000101
207 Ga0207667_10002608
208 Ga0207712_10079355
209 Ga0207640_10000459
210 Ga0207678_10058463
211 Ga0207708_10154025
212 Ga0207708_11268107
213 Ga0207702_10026224
214 Ga0207641_11055385
215 Ga0207648_10799176
216 Ga0268264_10344210
217 Ga0265338_10386526
218 Ga0265760_10000639
219 Ga0307514_10437883
220 Ga0307516_10054387
221 Ga0307406_10050718
222 Ga0307412_10959954
223 Ga0307415_100144359
224 Ga0373936_0000001
225 Ga0373941_0003134
226 Ga0373960_0356293
227 Ga0373961_0000001
228 Ga0373935_0052817
229 Ga0395899_0131251
230 Ga0395900_0032004
231 Ga0395898_0085710
232 Ga0395905_1096241
233 Ga0436364_0273345
234 Ga0395901_0032523
235 Ga0395901_1058745
236 Ga0436365_0730574
237 Ga0436365_1532545
238 Ga0436360_0097301
239 Ga0436360_0173106
240 Ga0436360_1002092
241 Ga0436360_1044118
242 Ga0436360_1063004
243 Ga0436360_1296053
244 Ga0436361_0654078
245 Ga0436361_0686581
246 Ga0436361_1084917
247 Ga0436363_1208593
248 Ga0436363_1707220
249 Ga0436362_0064962
250 Ga0436362_0164319
251 Ga0436362_0398004
252 Ga0466966_0047511
253 Ga0466966_0205075
254 Ga0466963_0014309
255 Ga0466964_0317471
256 Ga0466957_0325288
257 Ga0466957_0407518
258 Ga0466959_0242989
259 Ga0466958_0060521
260 Ga0466958_0206729
261 Ga0466967_0014090
262 Ga0466967_0430011
263 Ga0466967_0988164
264 Ga0495659_0359897
265 Ga0495649_0148663
266 Ga0495686_0017690
267 Ga0496126_1232912
268 Ga0501070_0837805
269 nmdc:mga03683_663328_c1
270 nmdc:mga0n895_1360787_c1
271 nmdc:mga0n895_1489170_c1
272 Ga0500647_0360371
273 Ga0500566_0095309
274 Ga0500640_000856
275 Ga0500554_000228
276 Ga0500572_005360
277 Ga0500595_000273
278 Ga0500597_049449
279 Ga0500614_001594
280 Ga0500642_0015102
281 Ga0500559_0007088
282 Ga0500564_123967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

20

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8623 2 135
1nmn-assembly2.cif.gz_B structure of yqgf from escherichia coli, a hypothetical protein 0.831 2 135
7ess-assembly1.cif.gz_A structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.8307 2 135
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8301 2 135
1nu0-assembly1.cif.gz_A structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.8271 2 137
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8842 1 136 3.30.420.140
af_Q8GYR7_22_166_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8674 1 136 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8589 4 136 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8433 1 136 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8397 2 136 3.30.420.140
ID Description Score Start End GO Terms
AF-A0A521LF53-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9775 1 136 GO:0000967
GO:0004518
GO:0005829
AF-A0A2V7V5T4-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9761 1 138 GO:0000967
GO:0004518
GO:0005829
AF-A0A7X4B4R6-F1-model_v4 Holliday junction resolvase RuvX 0.9732 2 133 GO:0000967
GO:0004518
GO:0005829
AF-X1G2L9-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9673 1 90 GO:0000967
GO:0004518
GO:0005829
AF-A0A2E1VQ73-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9632 2 137 GO:0000967
GO:0004518
GO:0005829

Map