F182766

General Info

Members Datasets Scaffolds Average Seq Length
141 90 282 168

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1043237|Ga0209758_10432372
Length 191
Sequence MLTSMAGAGQGTIRAYPEDHPVVPASPKLPQSLTRLYARPGFLLRRAHQISAAVFEDACRDLSLTPAQFGVLTVLQAHPGLGQSTLARALGFDKVTVLRVLRGLETRGLVARAPAPDNRRNVSVALTREGEQVLQQAQKPAERAYKRLMAPLTREQQEQLLDLLQLLTGELEDEARAAFVPPSAPATRQVA

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
36 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
46 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
47 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
51 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
52 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
53 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
54 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
55 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
56 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
69 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
70 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
71 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
72 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
73 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
88 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
89 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.73
Nodule 0
Rhizoplane 2.13
Rhizosphere 78.72
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1043237 3300025297 Bacteria 1662
2 Ga0055540_1016713 3300003792 Bacteria 2075
3 Ga0055531_10001933 3300003794 Bacteria 14480
4 Ga0070658_10260034 3300005327 Bacteria 1474
5 Ga0070658_10656602 3300005327 Bacteria 910
6 Ga0068869_100144770 3300005334 Bacteria 1838
7 Ga0068868_100092735 3300005338 Bacteria 2434
8 Ga0068853_100302356 3300005539 Bacteria 1479
9 Ga0068855_100093546 3300005563 Bacteria 3466
10 Ga0068866_10641762 3300005718 Bacteria 722
11 Ga0075365_10012836 3300006038 Bacteria 4991
12 Ga0075368_10288772 3300006042 Bacteria 706
13 Ga0075362_10060691 3300006177 Bacteria 1709
14 Ga0075362_10237093 3300006177 Bacteria 895
15 Ga0075367_10257734 3300006178 Bacteria 1094
16 Ga0075367_10493681 3300006178 Bacteria 776
17 Ga0075366_10050844 3300006195 Bacteria 2462
18 Ga0075366_10147782 3300006195 Bacteria 1422
19 Ga0075366_10408407 3300006195 Bacteria 836
20 Ga0075370_10515678 3300006353 Bacteria 722
21 Ga0075370_10672231 3300006353 Bacteria 629
22 Ga0075429_100119265 3300006880 Bacteria 2305
23 Ga0105245_10273025 3300009098 Bacteria 1650
24 Ga0105243_12199365 3300009148 Bacteria 588
25 Ga0157374_11013796 3300013296 Bacteria 849
26 Ga0157378_10076690 3300013297 Bacteria 3012
27 Ga0157372_12053235 3300013307 Bacteria 657
28 Ga0157376_10001949 3300014969 Bacteria 13795
29 Ga0209673_1032752 3300025273 Bacteria 1597
30 Ga0207426_1086197 3300025302 Bacteria 841
31 Ga0209051_1004364 3300025303 Bacteria 8758
32 Ga0209257_1000012 3300025304 Bacteria 1111138
33 Ga0207705_10118435 3300025909 Bacteria 1963
34 Ga0207705_10434706 3300025909 Bacteria 1017
35 Ga0207687_10043205 3300025927 Bacteria 3104
36 Ga0207667_10088447 3300025949 Bacteria 3204
37 Ga0207677_10072405 3300026023 Bacteria 2436
38 Ga0207677_10476930 3300026023 Bacteria 1074
39 Ga0207702_10144229 3300026078 Bacteria 2159
40 Ga0265330_10092331 3300031235 Bacteria 1299
41 Ga0307513_10000012 3300031456 Bacteria 328865
42 Ga0307408_100032626 3300031548 Bacteria 3632
43 Ga0307408_100331010 3300031548 Bacteria 1286
44 Ga0265314_10006621 3300031711 Bacteria 10193
45 Ga0265342_10091966 3300031712 Bacteria 1738
46 Ga0265342_10163661 3300031712 Bacteria 1228
47 Ga0307516_10004265 3300031730 Bacteria 17778
48 Ga0307412_10487859 3300031911 Unclassified 1023
49 Ga0307412_10547038 3300031911 Bacteria 972
50 Ga0307416_101657517 3300032002 Bacteria 744
51 Ga0395899_0003569 3300037312 Bacteria 12314
52 Ga0395900_0011387 3300037418 Bacteria 9102
53 Ga0395900_0044241 3300037418 Bacteria 4588
54 Ga0395900_0074890 3300037418 Bacteria 3480
55 Ga0395900_0398881 3300037418 Bacteria 1340
56 Ga0395900_0478921 3300037418 Bacteria 1197
57 Ga0395898_0015942 3300037466 Bacteria 7701
58 Ga0395898_0023074 3300037466 Bacteria 6292
59 Ga0395898_0064652 3300037466 Bacteria 3548
60 Ga0395898_0292068 3300037466 Bacteria 1555
61 Ga0395905_0002491 3300037471 Bacteria 20362
62 Ga0395905_0008481 3300037471 Bacteria 10135
63 Ga0395905_0052258 3300037471 Bacteria 3825
64 Ga0395905_0069183 3300037471 Bacteria 3306
65 Ga0395905_0083297 3300037471 Bacteria 2996
66 Ga0395905_0086645 3300037471 Bacteria 2936
67 Ga0395905_0197009 3300037471 Bacteria 1889
68 Ga0395905_0354982 3300037471 Bacteria 1358
69 Ga0395905_1190469 3300037471 Bacteria 665
70 Ga0395901_0021044 3300038443 Bacteria 6681
71 Ga0395901_0044502 3300038443 Bacteria 4604
72 Ga0395901_0073845 3300038443 Bacteria 3557
73 Ga0395901_0131188 3300038443 Bacteria 2633
74 Ga0395901_0155727 3300038443 Bacteria 2400
75 Ga0395901_0239593 3300038443 Bacteria 1892
76 Ga0395901_0373732 3300038443 Bacteria 1468
77 Ga0439439_0005352 3300041406 Bacteria 2928
78 Ga0439453_0002035 3300041408 Bacteria 2724
79 Ga0451807_0163922 3300041486 Bacteria 1508
80 Ga0451807_1128579 3300041486 Bacteria 880
81 Ga0439433_0119184 3300041999 Bacteria 664
82 Ga0439449_0001800 3300042007 Bacteria 8435
83 Ga0439449_0098339 3300042007 Bacteria 1081
84 Ga0439457_008504 3300042014 Bacteria 2417
85 Ga0450890_010871 3300042127 Bacteria 1172
86 Ga0450903_064082 3300042138 Unclassified 532
87 Ga0439446_0006432 3300042156 Bacteria 3061
88 Ga0439458_0006854 3300042157 Bacteria 2539
89 Ga0439464_0006696 3300042439 Bacteria 3005
90 Ga0450893_0066936 3300042532 Bacteria 693
91 Ga0466969_0055217 3300044656 Bacteria 1943
92 Ga0466969_0069677 3300044656 Bacteria 1693
93 Ga0466972_0153175 3300044658 Bacteria 1083
94 Ga0466972_0420701 3300044658 Bacteria 627
95 Ga0453683_0019560 3300044673 Bacteria 4335
96 Ga0466965_0083585 3300044683 Bacteria 1616
97 Ga0466966_0025741 3300044684 Bacteria 3843
98 Ga0466966_0082012 3300044684 Bacteria 2007
99 Ga0466961_0013712 3300044693 Bacteria 5194
100 Ga0466961_0149661 3300044693 Bacteria 1458
101 Ga0466961_0551035 3300044693 Bacteria 694
102 Ga0466970_0041936 3300044765 Bacteria 2433
103 Ga0466970_0303459 3300044765 Bacteria 901
104 Ga0466970_0427412 3300044765 Bacteria 758
105 Ga0466957_0090373 3300044842 Bacteria 1918
106 Ga0466957_0157799 3300044842 Bacteria 1472
107 Ga0466959_0133904 3300045049 Bacteria 1755
108 Ga0451576_0003667 3300045051 Bacteria 20840
109 Ga0451576_0925819 3300045051 Bacteria 914
110 Ga0466958_0168328 3300045836 Bacteria 1387
111 Ga0495656_0021966 3300046615 Bacteria 2492
112 Ga0495656_0041872 3300046615 Bacteria 1916
113 Ga0495669_0071707 3300046684 Bacteria 1580
114 Ga0495670_0354320 3300046691 Bacteria 790
115 Ga0495636_0105263 3300047318 Bacteria 1237
116 Ga0495677_0037239 3300047445 Bacteria 1777
117 Ga0495615_0087734 3300048090 Bacteria 862
118 Ga0496110_0903675 3300048913 Bacteria 789
119 Ga0501031_0422309 3300049568 Bacteria 862
120 Ga0501033_0178666 3300049570 Bacteria 1522
121 Ga0501034_0322936 3300049571 Bacteria 1476
122 Ga0501036_0498182 3300049572 Bacteria 1014
123 Ga0501043_0200899 3300049579 Bacteria 1547
124 Ga0501046_0155508 3300049580 Bacteria 1723
125 Ga0501047_0142657 3300049581 Bacteria 2273
126 Ga0501047_0177309 3300049581 Bacteria 1998
127 Ga0501047_0202449 3300049581 Bacteria 1846
128 Ga0501048_0412588 3300049582 Bacteria 966
129 Ga0501080_0151231 3300049742 Bacteria 2145
130 Ga0501263_013948 3300049760 Bacteria 1025
131 Ga0501035_0095570 3300049822 Bacteria 2612
132 Ga0501044_0127969 3300049823 Bacteria 2536
133 Ga0501044_0386722 3300049823 Bacteria 1313
134 nmdc:mga03683_253203_c1 3300050489 Bacteria 818
135 nmdc:mga0yw44_179581_c1 3300050492 Bacteria 1393
136 nmdc:mga0yw44_28625_c1 3300050492 Bacteria 3207
137 nmdc:mga0yw44_375647_c1 3300050492 Bacteria 959
138 nmdc:mga0k408_197323_c1 3300050493 Bacteria 1201
139 nmdc:mga0k408_36608_c1 3300050493 Bacteria 2816
140 nmdc:mga0k408_391784_c1 3300050493 Bacteria 827
141 nmdc:mga09592_217866_c1 3300050508 Bacteria 1654
142 Ga0209758_1043237
143 Ga0055540_1016713
144 Ga0055531_10001933
145 Ga0070658_10260034
146 Ga0070658_10656602
147 Ga0068869_100144770
148 Ga0068868_100092735
149 Ga0068853_100302356
150 Ga0068855_100093546
151 Ga0068866_10641762
152 Ga0075365_10012836
153 Ga0075368_10288772
154 Ga0075362_10060691
155 Ga0075362_10237093
156 Ga0075367_10257734
157 Ga0075367_10493681
158 Ga0075366_10050844
159 Ga0075366_10147782
160 Ga0075366_10408407
161 Ga0075370_10515678
162 Ga0075370_10672231
163 Ga0075429_100119265
164 Ga0105245_10273025
165 Ga0105243_12199365
166 Ga0157374_11013796
167 Ga0157378_10076690
168 Ga0157372_12053235
169 Ga0157376_10001949
170 Ga0209673_1032752
171 Ga0207426_1086197
172 Ga0209051_1004364
173 Ga0209257_1000012
174 Ga0207705_10118435
175 Ga0207705_10434706
176 Ga0207687_10043205
177 Ga0207667_10088447
178 Ga0207677_10072405
179 Ga0207677_10476930
180 Ga0207702_10144229
181 Ga0265330_10092331
182 Ga0307513_10000012
183 Ga0307408_100032626
184 Ga0307408_100331010
185 Ga0265314_10006621
186 Ga0265342_10091966
187 Ga0265342_10163661
188 Ga0307516_10004265
189 Ga0307412_10487859
190 Ga0307412_10547038
191 Ga0307416_101657517
192 Ga0395899_0003569
193 Ga0395900_0011387
194 Ga0395900_0044241
195 Ga0395900_0074890
196 Ga0395900_0398881
197 Ga0395900_0478921
198 Ga0395898_0015942
199 Ga0395898_0023074
200 Ga0395898_0064652
201 Ga0395898_0292068
202 Ga0395905_0002491
203 Ga0395905_0008481
204 Ga0395905_0052258
205 Ga0395905_0069183
206 Ga0395905_0083297
207 Ga0395905_0086645
208 Ga0395905_0197009
209 Ga0395905_0354982
210 Ga0395905_1190469
211 Ga0395901_0021044
212 Ga0395901_0044502
213 Ga0395901_0073845
214 Ga0395901_0131188
215 Ga0395901_0155727
216 Ga0395901_0239593
217 Ga0395901_0373732
218 Ga0439439_0005352
219 Ga0439453_0002035
220 Ga0451807_0163922
221 Ga0451807_1128579
222 Ga0439433_0119184
223 Ga0439449_0001800
224 Ga0439449_0098339
225 Ga0439457_008504
226 Ga0450890_010871
227 Ga0450903_064082
228 Ga0439446_0006432
229 Ga0439458_0006854
230 Ga0439464_0006696
231 Ga0450893_0066936
232 Ga0466969_0055217
233 Ga0466969_0069677
234 Ga0466972_0153175
235 Ga0466972_0420701
236 Ga0453683_0019560
237 Ga0466965_0083585
238 Ga0466966_0025741
239 Ga0466966_0082012
240 Ga0466961_0013712
241 Ga0466961_0149661
242 Ga0466961_0551035
243 Ga0466970_0041936
244 Ga0466970_0303459
245 Ga0466970_0427412
246 Ga0466957_0090373
247 Ga0466957_0157799
248 Ga0466959_0133904
249 Ga0451576_0003667
250 Ga0451576_0925819
251 Ga0466958_0168328
252 Ga0495656_0021966
253 Ga0495656_0041872
254 Ga0495669_0071707
255 Ga0495670_0354320
256 Ga0495636_0105263
257 Ga0495677_0037239
258 Ga0495615_0087734
259 Ga0496110_0903675
260 Ga0501031_0422309
261 Ga0501033_0178666
262 Ga0501034_0322936
263 Ga0501036_0498182
264 Ga0501043_0200899
265 Ga0501046_0155508
266 Ga0501047_0142657
267 Ga0501047_0177309
268 Ga0501047_0202449
269 Ga0501048_0412588
270 Ga0501080_0151231
271 Ga0501263_013948
272 Ga0501035_0095570
273 Ga0501044_0127969
274 Ga0501044_0386722
275 nmdc:mga03683_253203_c1
276 nmdc:mga0yw44_179581_c1
277 nmdc:mga0yw44_28625_c1
278 nmdc:mga0yw44_375647_c1
279 nmdc:mga0k408_197323_c1
280 nmdc:mga0k408_36608_c1
281 nmdc:mga0k408_391784_c1
282 nmdc:mga09592_217866_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

64

122

0.99

PF12802

MarR_2

MarR family

62

121

0.98

PF09339

HTH_IclR

IclR helix-turn-helix domain

69

114

0.93

PF13463

HTH_27

Winged helix DNA-binding domain

64

130

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.964 45 104
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9626 45 86
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9516 46 86
6pco-assembly1.cif.gz_B mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid 0.9498 15 147
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9477 49 104
ID Description Score Start End Superfamily
af_Q2G033_15_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9823 45 120 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9633 42 103 1.10.10.10
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 45 86 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 45 105 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9565 42 116 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Z8KWY6-F1-model_v4 HTH marR-type domain-containing protein 0.9719 14 145 GO:0003700
AF-A0A2A4MV90-F1-model_v4 MarR family transcriptional regulator 0.965 14 146 GO:0003700
GO:0006950
AF-A0A7C7TYQ4-F1-model_v4 MarR family transcriptional regulator 0.9646 14 146 GO:0003700
GO:0006950
AF-A0A0P7XWE6-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9644 15 145 GO:0003677
GO:0003700
GO:0006950
AF-A0A7Y0HD06-F1-model_v4 MarR family transcriptional regulator 0.9622 12 152 GO:0003700
GO:0006950

Map