F181655

General Info

Members Datasets Scaffolds Average Seq Length
141 111 141 263

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100155021|Ga0070682_1001550212
Length 306
Sequence MLSRLFPLCGRNHDNARDGGPAATVIGMPSAQIPWRGPGSDRPALPLPPGPMPLRLHGQTRKRWRYIGLFGEELMLCAARAEIGPLGQCFWVMWDRQGRRHRAHTSLRPGSREVWMDGPRLEIDSPGLRASLTLGEAAPIETICPSGAGWGWTRKRAGVPIEGTVEVPGRRWQVSAQGVDDESAGYHQRQTSWHWSAGVGEASDGRALAWNLVEGVNDPAVDSERAVWVDGVPHEPAPVRFRGLDAIEFAAGPALEFSSESAHARNENFLLVRSRYRHRFGTFSGALDEIPLATGFGVMEQHDAVW

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
72 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
107 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 10.64
Rhizosphere 80.14
Stem 0
Stem Tuber 0
Unclassified 7.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100012363 3300005329 Bacteria 7415
2 Ga0070683_100109259 3300005329 Bacteria 2608
3 Ga0070666_10069038 3300005335 Bacteria 2402
4 Ga0070682_100155021 3300005337 Bacteria 1576
5 Ga0070691_10001500 3300005341 Bacteria 10017
6 Ga0070661_100000005 3300005344 Bacteria 220455
7 Ga0070668_100002168 3300005347 Bacteria 14376
8 Ga0070688_100110796 3300005365 Bacteria 1825
9 Ga0070667_100000789 3300005367 Bacteria 29706
10 Ga0070667_100051927 3300005367 Bacteria 3457
11 Ga0070667_100130007 3300005367 Bacteria 2197
12 Ga0070714_100286031 3300005435 Bacteria 1533
13 Ga0070713_100176794 3300005436 Bacteria 1916
14 Ga0070711_100037863 3300005439 Bacteria 3238
15 Ga0070678_100216697 3300005456 Bacteria 1589
16 Ga0068867_100288097 3300005459 Bacteria 1349
17 Ga0068853_100079085 3300005539 Bacteria 2875
18 Ga0070665_100001712 3300005548 Bacteria 25155
19 Ga0070665_100013970 3300005548 Bacteria 8076
20 Ga0070665_100215122 3300005548 Bacteria 1923
21 Ga0070664_100007569 3300005564 Bacteria 8770
22 Ga0068857_100133449 3300005577 Bacteria 2241
23 Ga0068856_100000064 3300005614 Bacteria 98907
24 Ga0068856_100130951 3300005614 Bacteria 2513
25 Ga0068852_100000467 3300005616 Bacteria 26599
26 Ga0068852_100010793 3300005616 Bacteria 6843
27 Ga0068851_10013025 3300005834 Bacteria 3932
28 Ga0068858_100184842 3300005842 Bacteria 1969
29 Ga0068860_100360327 3300005843 Bacteria 1432
30 Ga0068862_100002577 3300005844 Bacteria 16010
31 Ga0081455_10015335 3300005937 Bacteria 7451
32 Ga0097621_100383156 3300006237 Unclassified 1256
33 Ga0075431_100144326 3300006847 Bacteria 2453
34 Ga0105245_10000056 3300009098 Bacteria 124109
35 Ga0105242_10000605 3300009176 Bacteria 28087
36 Ga0105242_10000667 3300009176 Bacteria 26876
37 Ga0105249_10037026 3300009553 Bacteria 4427
38 Ga0157371_10005068 3300013102 Bacteria 11253
39 Ga0157374_10458101 3300013296 Bacteria 1277
40 Ga0157378_10116559 3300013297 Bacteria 2456
41 Ga0157375_10021856 3300013308 Bacteria 5878
42 Ga0157380_10151961 3300014326 Bacteria 2002
43 Ga0157379_10510467 3300014968 Bacteria 1115
44 Ga0207656_10010841 3300025321 Bacteria 3427
45 Ga0207680_10015443 3300025903 Bacteria 3984
46 Ga0207693_10000853 3300025915 Bacteria 27203
47 Ga0207657_10246012 3300025919 Bacteria 1427
48 Ga0207649_10000005 3300025920 Bacteria 356179
49 Ga0207650_10056390 3300025925 Bacteria 2919
50 Ga0207687_10000007 3300025927 Bacteria 604185
51 Ga0207664_10491131 3300025929 Bacteria 1099
52 Ga0207690_10027413 3300025932 Bacteria 3600
53 Ga0207691_10000020 3300025940 Bacteria 133465
54 Ga0207711_10000020 3300025941 Bacteria 363325
55 Ga0207661_10005053 3300025944 Bacteria 9258
56 Ga0207661_10021059 3300025944 Bacteria 4883
57 Ga0207679_10080849 3300025945 Bacteria 2483
58 Ga0207712_10019741 3300025961 Bacteria 4404
59 Ga0207658_10001558 3300025986 Bacteria 17760
60 Ga0207658_10065390 3300025986 Bacteria 2731
61 Ga0207703_10123881 3300026035 Bacteria 2222
62 Ga0207702_10000016 3300026078 Bacteria 226633
63 Ga0207702_10018085 3300026078 Bacteria 5832
64 Ga0207641_10012998 3300026088 Bacteria 6829
65 Ga0207641_10074824 3300026088 Bacteria 2923
66 Ga0207676_10000025 3300026095 Bacteria 261714
67 Ga0207674_10101390 3300026116 Bacteria 2859
68 Ga0207683_10016747 3300026121 Bacteria 6239
69 Ga0207698_10000041 3300026142 Bacteria 97882
70 Ga0268266_10000789 3300028379 Bacteria 42235
71 Ga0268266_10046183 3300028379 Bacteria 3729
72 Ga0268266_10196282 3300028379 Bacteria 1845
73 Ga0268265_10011319 3300028380 Bacteria 6032
74 Ga0265319_1000028 3300028563 Bacteria 135557
75 Ga0265338_10000230 3300028800 Bacteria 103891
76 Ga0265331_10040136 3300031250 Bacteria 2278
77 Ga0451833_0887515 3300041491 Bacteria 1848
78 Ga0466963_0056899 3300044694 Bacteria 2603
79 Ga0495629_0001932 3300046459 Bacteria 16149
80 Ga0495629_0004005 3300046459 Bacteria 11072
81 Ga0495594_0000032 3300046499 Bacteria 63783
82 Ga0495606_0000211 3300046507 Bacteria 103386
83 Ga0495608_0000208 3300046511 Bacteria 42275
84 Ga0495630_0000025 3300046517 Bacteria 152364
85 Ga0495622_0000014 3300046557 Bacteria 182142
86 Ga0495588_0000852 3300046674 Bacteria 13501
87 Ga0495657_0000406 3300046675 Bacteria 40241
88 Ga0495624_0013275 3300046690 Bacteria 5615
89 Ga0495604_0006256 3300047317 Bacteria 9443
90 Ga0495672_0117447 3300047320 Bacteria 1419
91 Ga0495676_0288485 3300047321 Bacteria 1109
92 Ga0495675_0003826 3300047444 Bacteria 9115
93 Ga0495686_0014477 3300047472 Bacteria 5426
94 Ga0495602_0000032 3300048088 Bacteria 141185
95 Ga0496102_0189072 3300048905 Bacteria 1940
96 Ga0496103_0018038 3300048906 Bacteria 4230
97 Ga0496104_0000002 3300048907 Bacteria 686017
98 Ga0496105_0000001 3300048908 Bacteria 1328178
99 Ga0496108_0000045 3300048911 Bacteria 137416
100 Ga0496108_0002380 3300048911 Bacteria 15044
101 Ga0496109_0000032 3300048912 Bacteria 162984
102 Ga0496109_0000252 3300048912 Bacteria 51599
103 Ga0496109_0189813 3300048912 Bacteria 1931
104 Ga0496110_0050516 3300048913 Bacteria 3651
105 Ga0496110_0398900 3300048913 Bacteria 1254
106 Ga0496111_0100822 3300048914 Bacteria 2121
107 Ga0496114_0000003 3300048917 Bacteria 630981
108 Ga0496115_0000020 3300048918 Bacteria 171995
109 Ga0496115_0000036 3300048918 Bacteria 127774
110 Ga0496116_0000668 3300048919 Bacteria 44706
111 Ga0496117_0002954 3300048920 Bacteria 20541
112 Ga0496117_0075004 3300048920 Bacteria 2249
113 Ga0496117_0123949 3300048920 Bacteria 1581
114 Ga0496118_0001180 3300048921 Bacteria 40327
115 Ga0496119_0002772 3300048922 Bacteria 18820
116 Ga0496119_0007150 3300048922 Bacteria 10122
117 Ga0496119_0197272 3300048922 Bacteria 1044
118 Ga0496121_0032496 3300048924 Bacteria 4742
119 Ga0496126_0193058 3300048929 Bacteria 1724
120 Ga0501043_0200049 3300049579 Bacteria 1551
121 Ga0501069_0008413 3300049585 Bacteria 5422
122 Ga0501069_0142012 3300049585 Bacteria 1377
123 Ga0501070_0015861 3300049586 Bacteria 6334
124 Ga0501070_0079276 3300049586 Bacteria 2717
125 Ga0501070_0154945 3300049586 Bacteria 1889
126 Ga0501071_0128522 3300049587 Bacteria 1882
127 Ga0501080_0512100 3300049742 Unclassified 1071
128 Ga0501081_0078777 3300049743 Bacteria 2304
129 Ga0501083_0007685 3300049744 Bacteria 7644
130 Ga0501083_0037016 3300049744 Bacteria 3325
131 Ga0501044_0094647 3300049823 Bacteria 3011
132 Ga0501044_0100772 3300049823 Bacteria 2906
133 Ga0501044_0418261 3300049823 Bacteria 1251
134 nmdc:mga06r32_88716_c1 3300050510 Bacteria 3019
135 nmdc:mga0rr50_381776_c1 3300050513 Bacteria 1188
136 Ga0495612_0028551 3300053078 Bacteria 2247
137 Ga0495655_0000011 3300053083 Bacteria 118490
138 Ga0495595_0000091 3300053084 Bacteria 42155
139 Ga0495619_0000141 3300053085 Bacteria 53921
140 Ga0500595_014498 3300053119 Bacteria 2989
141 Ga0500628_000032 3300053129 Bacteria 52752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046690 Ga0495624_0013275 Ga0495624_0013275_4785_5450 221
2 3300048913 Ga0496110_0398900 Ga0496110_0398900_529_1209 223
3 3300025919 Ga0207657_10246012 Ga0207657_102460122 225
4 3300005564 Ga0070664_100007569 Ga0070664_10000756910 239
5 3300025945 Ga0207679_10080849 Ga0207679_100808492 239
6 3300005344 Ga0070661_100000005 Ga0070661_100000005166 242
7 3300025920 Ga0207649_10000005 Ga0207649_10000005309 242
8 3300050513 nmdc:mga0rr50_381776_c1 nmdc:mga0rr50_381776_c1_116_952 243
9 3300048911 Ga0496108_0002380 Ga0496108_0002380_6466_7251 248
10 3300048912 Ga0496109_0000252 Ga0496109_0000252_23595_24380 248
11 3300005614 Ga0068856_100000064 Ga0068856_10000006420 249
12 3300026078 Ga0207702_10000016 Ga0207702_1000001661 249
13 3300005539 Ga0068853_100079085 Ga0068853_1000790853 252
14 3300005435 Ga0070714_100286031 Ga0070714_1002860313 254
15 3300005937 Ga0081455_10015335 Ga0081455_100153352 254
16 3300044694 Ga0466963_0056899 Ga0466963_0056899_1476_2258 254
17 3300047320 Ga0495672_0117447 Ga0495672_0117447_289_1068 254
18 3300048918 Ga0496115_0000020 Ga0496115_0000020_86620_87384 254
19 3300005367 Ga0070667_100051927 Ga0070667_1000519273 255
20 3300005367 Ga0070667_100130007 Ga0070667_1001300072 255
21 3300005548 Ga0070665_100013970 Ga0070665_1000139707 255
22 3300005842 Ga0068858_100184842 Ga0068858_1001848423 255
23 3300006847 Ga0075431_100144326 Ga0075431_1001443262 255
24 3300009176 Ga0105242_10000605 Ga0105242_1000060521 255
25 3300013308 Ga0157375_10021856 Ga0157375_100218566 255
26 3300025927 Ga0207687_10000007 Ga0207687_1000000773 255
27 3300026035 Ga0207703_10123881 Ga0207703_101238812 255
28 3300028379 Ga0268266_10046183 Ga0268266_100461833 255
29 3300041491 Ga0451833_0887515 Ga0451833_0887515_45_812 255
30 3300046459 Ga0495629_0004005 Ga0495629_0004005_1896_2663 255
31 3300046499 Ga0495594_0000032 Ga0495594_0000032_1388_2155 255
32 3300046557 Ga0495622_0000014 Ga0495622_0000014_168847_169614 255
33 3300048905 Ga0496102_0189072 Ga0496102_0189072_1138_1905 255
34 3300048906 Ga0496103_0018038 Ga0496103_0018038_2538_3305 255
35 3300048907 Ga0496104_0000002 Ga0496104_0000002_601362_602138 255
36 3300048908 Ga0496105_0000001 Ga0496105_0000001_726041_726817 255
37 3300048912 Ga0496109_0189813 Ga0496109_0189813_276_1043 255
38 3300048913 Ga0496110_0050516 Ga0496110_0050516_1085_1852 255
39 3300048914 Ga0496111_0100822 Ga0496111_0100822_1181_1948 255
40 3300048917 Ga0496114_0000003 Ga0496114_0000003_218331_219098 255
41 3300048918 Ga0496115_0000036 Ga0496115_0000036_50670_51437 255
42 3300048919 Ga0496116_0000668 Ga0496116_0000668_5320_6087 255
43 3300048920 Ga0496117_0002954 Ga0496117_0002954_1993_2760 255
44 3300048920 Ga0496117_0075004 Ga0496117_0075004_400_1167 255
45 3300048920 Ga0496117_0123949 Ga0496117_0123949_745_1512 255
46 3300048921 Ga0496118_0001180 Ga0496118_0001180_37048_37815 255
47 3300048922 Ga0496119_0002772 Ga0496119_0002772_5303_6070 255
48 3300048922 Ga0496119_0007150 Ga0496119_0007150_921_1697 255
49 3300048922 Ga0496119_0197272 Ga0496119_0197272_249_1016 255
50 3300048924 Ga0496121_0032496 Ga0496121_0032496_2416_3183 255
51 3300048929 Ga0496126_0193058 Ga0496126_0193058_656_1423 255
52 3300049586 Ga0501070_0015861 Ga0501070_0015861_3038_3805 255
53 3300049742 Ga0501080_0512100 Ga0501080_0512100_240_1007 255
54 3300049743 Ga0501081_0078777 Ga0501081_0078777_562_1329 255
55 3300049744 Ga0501083_0007685 Ga0501083_0007685_6199_6966 255
56 3300049823 Ga0501044_0100772 Ga0501044_0100772_623_1390 255
57 3300049823 Ga0501044_0418261 Ga0501044_0418261_433_1200 255
58 3300050510 nmdc:mga06r32_88716_c1 nmdc:mga06r32_88716_c1_1267_2034 255
59 3300053083 Ga0495655_0000011 Ga0495655_0000011_20070_20837 255
60 3300053119 Ga0500595_014498 Ga0500595_014498_952_1719 255
61 3300053129 Ga0500628_000032 Ga0500628_000032_20875_21642 255
62 3300014326 Ga0157380_10151961 Ga0157380_101519614 258
63 3300046674 Ga0495588_0000852 Ga0495588_0000852_1189_1965 258
64 3300005335 Ga0070666_10069038 Ga0070666_100690382 259
65 3300005436 Ga0070713_100176794 Ga0070713_1001767942 259
66 3300005548 Ga0070665_100001712 Ga0070665_10000171219 259
67 3300005616 Ga0068852_100010793 Ga0068852_1000107937 259
68 3300025903 Ga0207680_10015443 Ga0207680_100154434 259
69 3300028379 Ga0268266_10000789 Ga0268266_1000078928 259
70 3300046507 Ga0495606_0000211 Ga0495606_0000211_97788_98567 259
71 3300046511 Ga0495608_0000208 Ga0495608_0000208_31387_32166 259
72 3300046675 Ga0495657_0000406 Ga0495657_0000406_10110_10889 259
73 3300047317 Ga0495604_0006256 Ga0495604_0006256_1733_2563 259
74 3300047321 Ga0495676_0288485 Ga0495676_0288485_294_1073 259
75 3300047444 Ga0495675_0003826 Ga0495675_0003826_3324_4103 259
76 3300048088 Ga0495602_0000032 Ga0495602_0000032_12086_12916 259
77 3300053078 Ga0495612_0028551 Ga0495612_0028551_198_977 259
78 3300053084 Ga0495595_0000091 Ga0495595_0000091_10110_10889 259
79 3300053085 Ga0495619_0000141 Ga0495619_0000141_23749_24528 259
80 3300005456 Ga0070678_100216697 Ga0070678_1002166973 260
81 3300005459 Ga0068867_100288097 Ga0068867_1002880972 260
82 3300005577 Ga0068857_100133449 Ga0068857_1001334493 260
83 3300005614 Ga0068856_100130951 Ga0068856_1001309512 260
84 3300005616 Ga0068852_100000467 Ga0068852_1000004677 260
85 3300009098 Ga0105245_10000056 Ga0105245_1000005650 260
86 3300013296 Ga0157374_10458101 Ga0157374_104581012 260
87 3300013297 Ga0157378_10116559 Ga0157378_101165593 260
88 3300025915 Ga0207693_10000853 Ga0207693_1000085322 260
89 3300026078 Ga0207702_10018085 Ga0207702_100180855 260
90 3300026116 Ga0207674_10101390 Ga0207674_101013902 260
91 3300026121 Ga0207683_10016747 Ga0207683_100167476 260
92 3300026142 Ga0207698_10000041 Ga0207698_1000004123 260
93 3300048911 Ga0496108_0000045 Ga0496108_0000045_74139_74945 260
94 3300048912 Ga0496109_0000032 Ga0496109_0000032_62481_63287 260
95 3300005347 Ga0070668_100002168 Ga0070668_10000216813 261
96 3300005367 Ga0070667_100000789 Ga0070667_1000007893 261
97 3300005548 Ga0070665_100215122 Ga0070665_1002151222 261
98 3300005843 Ga0068860_100360327 Ga0068860_1003603272 261
99 3300005844 Ga0068862_100002577 Ga0068862_1000025777 261
100 3300009553 Ga0105249_10037026 Ga0105249_100370264 261
101 3300013102 Ga0157371_10005068 Ga0157371_100050683 261
102 3300014968 Ga0157379_10510467 Ga0157379_105104672 261
103 3300025925 Ga0207650_10056390 Ga0207650_100563902 261
104 3300025929 Ga0207664_10491131 Ga0207664_104911311 261
105 3300025961 Ga0207712_10019741 Ga0207712_100197414 261
106 3300025986 Ga0207658_10001558 Ga0207658_100015585 261
107 3300028379 Ga0268266_10196282 Ga0268266_101962822 261
108 3300028380 Ga0268265_10011319 Ga0268265_100113198 261
109 3300005337 Ga0070682_100155021 Ga0070682_1001550212 262
110 3300005341 Ga0070691_10001500 Ga0070691_1000150010 262
111 3300006237 Ga0097621_100383156 Ga0097621_1003831562 262
112 3300009176 Ga0105242_10000667 Ga0105242_1000066714 262
113 3300025986 Ga0207658_10065390 Ga0207658_100653903 262
114 3300026088 Ga0207641_10012998 Ga0207641_100129988 262
115 3300026088 Ga0207641_10074824 Ga0207641_100748243 262
116 3300026095 Ga0207676_10000025 Ga0207676_10000025244 262
117 3300028563 Ga0265319_1000028 Ga0265319_100002839 262
118 3300028800 Ga0265338_10000230 Ga0265338_10000230113 262
119 3300031250 Ga0265331_10040136 Ga0265331_100401361 262
120 3300047472 Ga0495686_0014477 Ga0495686_0014477_81_920 262
121 3300049579 Ga0501043_0200049 Ga0501043_0200049_375_1214 262
122 3300049585 Ga0501069_0008413 Ga0501069_0008413_60_899 262
123 3300049585 Ga0501069_0142012 Ga0501069_0142012_60_899 262
124 3300049586 Ga0501070_0079276 Ga0501070_0079276_955_1794 262
125 3300049586 Ga0501070_0154945 Ga0501070_0154945_248_1087 262
126 3300049587 Ga0501071_0128522 Ga0501071_0128522_672_1511 262
127 3300049744 Ga0501083_0037016 Ga0501083_0037016_1918_2757 262
128 3300049823 Ga0501044_0094647 Ga0501044_0094647_310_1149 262
129 3300005365 Ga0070688_100110796 Ga0070688_1001107963 266
130 3300005439 Ga0070711_100037863 Ga0070711_1000378633 266
131 3300005834 Ga0068851_10013025 Ga0068851_100130254 266
132 3300025321 Ga0207656_10010841 Ga0207656_100108413 266
133 3300046459 Ga0495629_0001932 Ga0495629_0001932_10560_11378 266
134 3300046517 Ga0495630_0000025 Ga0495630_0000025_38799_39599 266
135 3300005329 Ga0070683_100012363 Ga0070683_1000123633 267
136 3300005329 Ga0070683_100109259 Ga0070683_1001092592 267
137 3300025932 Ga0207690_10027413 Ga0207690_100274135 267
138 3300025940 Ga0207691_10000020 Ga0207691_1000002078 267
139 3300025941 Ga0207711_10000020 Ga0207711_10000020303 267
140 3300025944 Ga0207661_10005053 Ga0207661_100050535 267
141 3300025944 Ga0207661_10021059 Ga0207661_100210592 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22866

DUF2804_C

Domain of unknown function (DUF2804), C-terminal

193

300

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1omo-assembly1.cif.gz_B alanine dehydrogenase dimer w/bound nad (archaeal) 0.6893 27 71
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.6505 6 262
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.6273 6 262
7a0q-assembly1.cif.gz_A crystal structure of kievitone hydratase from nectria haematococca (c2 sg) 0.6102 23 267
7dmn-assembly1.cif.gz_A crystal structure of two pericyclases catalyzing [4+2] cycloaddition 0.6099 22 262
ID Description Score Start End Superfamily
af_Q54XI7_50_415_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.849 22 265 2.40.370.10
af_Q54ZB6_15_380_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.8268 9 265 2.40.160.10
2ichA01 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8039 22 149 2.40.370.10
af_Q54ZB6_15_380_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.7955 9 265 2.40.160.10
af_Q54XI7_50_415_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.7772 22 265 2.40.370.10
ID Description Score Start End GO Terms
AF-A0A838V3L9-F1-model_v4 DUF2804 family protein 0.9801 5 267
AF-A0A838V3L9-F1-model_v4 DUF2804 family protein 0.962 5 267
AF-A0A2T4UFR3-F1-model_v4 DUF2804 domain-containing protein 0.9512 8 267
AF-A0A6J4K447-F1-model_v4 DUF2804 domain-containing protein 0.9462 3 267
AF-A0A537W3B9-F1-model_v4 DUF2804 family protein 0.9436 2 267

Feature Viewer

pLDDT pTM Quality
92.07 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map