F181287

General Info

Members Datasets Scaffolds Average Seq Length
141 102 282 139

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10007609|JGI25406J46586_100076096
Length 151
Sequence VTLRYLLDTSIVSVPISKKPDATILERLDSHGPECAIAAPVWHELRYGCRRLPRGKRRTAVEEYLRDVVRGSFPNLPYDEAAATWHGEERARLEAIGRPAPFVDGQIAAVARVHGLVLVTVNDEDFVQFDGLTVENWSKPSAQRKAPRRAR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
40 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
41 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
42 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
66 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
67 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
82 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
83 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
90 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
100 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 0
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 31.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007609 3300003203 Bacteria 4931
2 Ga0070689_100000014 3300005340 Bacteria 185640
3 Ga0070668_100571685 3300005347 Unclassified 986
4 Ga0070669_100222465 3300005353 Unclassified 1493
5 Ga0070675_100149029 3300005354 Bacteria 2005
6 Ga0070713_100113766 3300005436 Bacteria 2363
7 Ga0070710_10209872 3300005437 Unclassified 1234
8 Ga0070694_100215034 3300005444 Bacteria 1439
9 Ga0068867_100238588 3300005459 Unclassified 1473
10 Ga0070672_100735688 3300005543 Unclassified 865
11 Ga0070686_100229392 3300005544 Bacteria 1346
12 Ga0070696_100251325 3300005546 Unclassified 1337
13 Ga0068863_100594963 3300005841 Unclassified 1094
14 Ga0081539_10000716 3300005985 Bacteria 66592
15 Ga0081539_10011501 3300005985 Bacteria 6988
16 Ga0070717_10919935 3300006028 Unclassified 796
17 Ga0075365_10350506 3300006038 Unclassified 1041
18 Ga0075364_10141640 3300006051 Unclassified 1617
19 Ga0097621_101284005 3300006237 Unclassified 691
20 Ga0068871_101148858 3300006358 Unclassified 727
21 Ga0075428_100051813 3300006844 Bacteria 4501
22 Ga0075429_100008043 3300006880 Bacteria 9166
23 Ga0111539_10314326 3300009094 Bacteria 1823
24 Ga0111539_10790983 3300009094 Unclassified 1104
25 Ga0114129_10036827 3300009147 Bacteria 6908
26 Ga0114129_10050773 3300009147 Bacteria 5824
27 Ga0114129_13002345 3300009147 Unclassified 555
28 Ga0105237_10135096 3300009545 Bacteria 2461
29 Ga0105249_10847338 3300009553 Unclassified 980
30 Ga0163163_10480317 3300014325 Bacteria 1304
31 Ga0157380_10085541 3300014326 Unclassified 2588
32 Ga0157380_10206917 3300014326 Unclassified 1745
33 Ga0157379_10767851 3300014968 Unclassified 908
34 Ga0157376_10420241 3300014969 Bacteria 1297
35 Ga0207692_10258831 3300025898 Unclassified 1045
36 Ga0207659_10115806 3300025926 Bacteria 2045
37 Ga0207670_10000834 3300025936 Bacteria 16145
38 Ga0265337_1028448 3300028556 Bacteria 1677
39 Ga0265326_10005237 3300028558 Bacteria 4090
40 Ga0265326_10019726 3300028558 Unclassified 1937
41 Ga0265334_10041220 3300028573 Bacteria 1805
42 Ga0265334_10089528 3300028573 Unclassified 1124
43 Ga0265318_10000010 3300028577 Bacteria 240629
44 Ga0265323_10007654 3300028653 Bacteria 4476
45 Ga0265323_10013903 3300028653 Bacteria 3199
46 Ga0265338_10082075 3300028800 Bacteria 2700
47 Ga0265338_10291346 3300028800 Bacteria 1189
48 Ga0265324_10000610 3300029957 Bacteria 24400
49 Ga0265330_10000206 3300031235 Bacteria 45608
50 Ga0265330_10000703 3300031235 Bacteria 21213
51 Ga0265330_10004268 3300031235 Bacteria 7279
52 Ga0265332_10000108 3300031238 Bacteria 70555
53 Ga0265328_10001070 3300031239 Bacteria 12632
54 Ga0265320_10000013 3300031240 Bacteria 240784
55 Ga0265329_10000112 3300031242 Bacteria 38219
56 Ga0265329_10005069 3300031242 Bacteria 5377
57 Ga0265329_10087673 3300031242 Bacteria 987
58 Ga0265339_10000014 3300031249 Bacteria 187463
59 Ga0265339_10050015 3300031249 Bacteria 2287
60 Ga0265331_10000056 3300031250 Bacteria 177651
61 Ga0265316_10000132 3300031344 Bacteria 81702
62 Ga0265316_10000208 3300031344 Bacteria 68236
63 Ga0265316_10004295 3300031344 Bacteria 14233
64 Ga0265316_10015790 3300031344 Bacteria 6582
65 Ga0265316_10195170 3300031344 Bacteria 1503
66 Ga0265313_10000464 3300031595 Bacteria 42754
67 Ga0265313_10029990 3300031595 Bacteria 2806
68 Ga0316579_10141619 3300031691 Bacteria 1159
69 Ga0316579_10238034 3300031691 Unclassified 881
70 Ga0265314_10000061 3300031711 Bacteria 159519
71 Ga0265314_10006867 3300031711 Bacteria 9973
72 Ga0265342_10004510 3300031712 Bacteria 10920
73 Ga0265342_10025779 3300031712 Bacteria 3691
74 Ga0265342_10053058 3300031712 Bacteria 2414
75 Ga0265342_10103008 3300031712 Bacteria 1623
76 Ga0316576_10049059 3300031727 Bacteria 3065
77 Ga0316576_10066893 3300031727 Bacteria 2644
78 Ga0316578_10039388 3300031728 Unclassified 2730
79 Ga0316578_10520585 3300031728 Unclassified 700
80 Ga0316578_10600104 3300031728 Unclassified 645
81 Ga0373934_0048705 3300035086 Bacteria 1678
82 Ga0373953_0031019 3300035117 Bacteria 2077
83 Ga0373954_0007781 3300035118 Bacteria 4691
84 Ga0373956_0102822 3300035119 Bacteria 1326
85 Ga0316574_0034600 3300035398 Bacteria 3082
86 Ga0316574_0043390 3300035398 Unclassified 2779
87 Ga0373924_0047604 3300035410 Unclassified 1769
88 Ga0373935_0816517 3300035692 Bacteria 689
89 Ga0373933_0000351 3300035724 Bacteria 29457
90 Ga0373937_0002300 3300036401 Bacteria 15962
91 Ga0373937_0042641 3300036401 Unclassified 4140
92 Ga0316582_0111510 3300036647 Bacteria 1821
93 Ga0316582_0278884 3300036647 Bacteria 1147
94 Ga0316582_0431711 3300036647 Bacteria 908
95 Ga0316582_0557327 3300036647 Bacteria 789
96 Ga0316584_0281724 3300036712 Bacteria 1207
97 Ga0400483_146934 3300039062 Unclassified 2889
98 Ga0400483_205470 3300039062 Bacteria 3686
99 Ga0400489_85717 3300039093 Unclassified 2581
100 Ga0400487_64307 3300039110 Unclassified 1011
101 Ga0451837_1048446 3300041494 Unclassified 1062
102 Ga0451853_1038479 3300041512 Bacteria 974
103 Ga0439431_0044173 3300041997 Bacteria 1142
104 Ga0453684_0029818 3300044712 Bacteria 7730
105 Ga0466960_0105186 3300044901 Unclassified 1459
106 Ga0495596_0046505 3300046500 Bacteria 1705
107 Ga0495622_0206836 3300046557 Unclassified 873
108 Ga0495589_0169118 3300046794 Unclassified 1039
109 Ga0495680_0429644 3300047322 Bacteria 907
110 Ga0496123_0457986 3300048926 Unclassified 566
111 Ga0501038_0334870 3300049574 Bacteria 1181
112 Ga0501043_0014948 3300049579 Bacteria 6080
113 Ga0501047_0036551 3300049581 Bacteria 4747
114 Ga0501067_0006604 3300049583 Bacteria 6432
115 Ga0501068_0000066 3300049584 Bacteria 41401
116 Ga0501068_0040227 3300049584 Unclassified 2805
117 Ga0501068_0684907 3300049584 Unclassified 670
118 Ga0501069_0006566 3300049585 Bacteria 6080
119 Ga0501069_0474300 3300049585 Unclassified 745
120 Ga0501071_0800249 3300049587 Unclassified 727
121 Ga0501072_0000180 3300049588 Bacteria 45646
122 Ga0501073_0317158 3300049589 Bacteria 1075
123 Ga0501074_0003189 3300049590 Bacteria 11566
124 Ga0501076_0002513 3300049592 Bacteria 12623
125 Ga0501077_0156720 3300049593 Bacteria 1445
126 Ga0501225_0212163 3300049705 Unclassified 619
127 Ga0501079_0000377 3300049741 Bacteria 28688
128 Ga0501080_0004613 3300049742 Bacteria 12273
129 Ga0501044_0012569 3300049823 Bacteria 9168
130 nmdc:mga0yw44_498661_c1 3300050492 Unclassified 826
131 nmdc:mga04h51_465361_c1 3300050495 Unclassified 536
132 nmdc:mga05p37_20702_c1 3300050507 Bacteria 7958
133 nmdc:mga05p37_46840_c1 3300050507 Bacteria 5316
134 nmdc:mga09592_1823_c1 3300050508 Bacteria 14503
135 nmdc:mga08y16_862070_c1 3300050511 Bacteria 894
136 Ga0495595_0067541 3300053084 Bacteria 1685
137 Ga0495619_0051151 3300053085 Bacteria 2730
138 Ga0501084_0000384 3300054114 Bacteria 33934
139 Ga0501084_0076610 3300054114 Bacteria 2804
140 Ga0501084_1564258 3300054114 Unclassified 551
141 Ga0501082_0007399 3300060353 Bacteria 9472
142 JGI25406J46586_10007609
143 Ga0070689_100000014
144 Ga0070668_100571685
145 Ga0070669_100222465
146 Ga0070675_100149029
147 Ga0070713_100113766
148 Ga0070710_10209872
149 Ga0070694_100215034
150 Ga0068867_100238588
151 Ga0070672_100735688
152 Ga0070686_100229392
153 Ga0070696_100251325
154 Ga0068863_100594963
155 Ga0081539_10000716
156 Ga0081539_10011501
157 Ga0070717_10919935
158 Ga0075365_10350506
159 Ga0075364_10141640
160 Ga0097621_101284005
161 Ga0068871_101148858
162 Ga0075428_100051813
163 Ga0075429_100008043
164 Ga0111539_10314326
165 Ga0111539_10790983
166 Ga0114129_10036827
167 Ga0114129_10050773
168 Ga0114129_13002345
169 Ga0105237_10135096
170 Ga0105249_10847338
171 Ga0163163_10480317
172 Ga0157380_10085541
173 Ga0157380_10206917
174 Ga0157379_10767851
175 Ga0157376_10420241
176 Ga0207692_10258831
177 Ga0207659_10115806
178 Ga0207670_10000834
179 Ga0265337_1028448
180 Ga0265326_10005237
181 Ga0265326_10019726
182 Ga0265334_10041220
183 Ga0265334_10089528
184 Ga0265318_10000010
185 Ga0265323_10007654
186 Ga0265323_10013903
187 Ga0265338_10082075
188 Ga0265338_10291346
189 Ga0265324_10000610
190 Ga0265330_10000206
191 Ga0265330_10000703
192 Ga0265330_10004268
193 Ga0265332_10000108
194 Ga0265328_10001070
195 Ga0265320_10000013
196 Ga0265329_10000112
197 Ga0265329_10005069
198 Ga0265329_10087673
199 Ga0265339_10000014
200 Ga0265339_10050015
201 Ga0265331_10000056
202 Ga0265316_10000132
203 Ga0265316_10000208
204 Ga0265316_10004295
205 Ga0265316_10015790
206 Ga0265316_10195170
207 Ga0265313_10000464
208 Ga0265313_10029990
209 Ga0316579_10141619
210 Ga0316579_10238034
211 Ga0265314_10000061
212 Ga0265314_10006867
213 Ga0265342_10004510
214 Ga0265342_10025779
215 Ga0265342_10053058
216 Ga0265342_10103008
217 Ga0316576_10049059
218 Ga0316576_10066893
219 Ga0316578_10039388
220 Ga0316578_10520585
221 Ga0316578_10600104
222 Ga0373934_0048705
223 Ga0373953_0031019
224 Ga0373954_0007781
225 Ga0373956_0102822
226 Ga0316574_0034600
227 Ga0316574_0043390
228 Ga0373924_0047604
229 Ga0373935_0816517
230 Ga0373933_0000351
231 Ga0373937_0002300
232 Ga0373937_0042641
233 Ga0316582_0111510
234 Ga0316582_0278884
235 Ga0316582_0431711
236 Ga0316582_0557327
237 Ga0316584_0281724
238 Ga0400483_146934
239 Ga0400483_205470
240 Ga0400489_85717
241 Ga0400487_64307
242 Ga0451837_1048446
243 Ga0451853_1038479
244 Ga0439431_0044173
245 Ga0453684_0029818
246 Ga0466960_0105186
247 Ga0495596_0046505
248 Ga0495622_0206836
249 Ga0495589_0169118
250 Ga0495680_0429644
251 Ga0496123_0457986
252 Ga0501038_0334870
253 Ga0501043_0014948
254 Ga0501047_0036551
255 Ga0501067_0006604
256 Ga0501068_0000066
257 Ga0501068_0040227
258 Ga0501068_0684907
259 Ga0501069_0006566
260 Ga0501069_0474300
261 Ga0501071_0800249
262 Ga0501072_0000180
263 Ga0501073_0317158
264 Ga0501074_0003189
265 Ga0501076_0002513
266 Ga0501077_0156720
267 Ga0501225_0212163
268 Ga0501079_0000377
269 Ga0501080_0004613
270 Ga0501044_0012569
271 nmdc:mga0yw44_498661_c1
272 nmdc:mga04h51_465361_c1
273 nmdc:mga05p37_20702_c1
274 nmdc:mga05p37_46840_c1
275 nmdc:mga09592_1823_c1
276 nmdc:mga08y16_862070_c1
277 Ga0495595_0067541
278 Ga0495619_0051151
279 Ga0501084_0000384
280 Ga0501084_0076610
281 Ga0501084_1564258
282 Ga0501082_0007399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

5

132

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9299 5 143
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9277 5 137
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.9046 3 137
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.9043 3 137
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.903 3 137
ID Description Score Start End Superfamily
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9303 5 140 3.40.50.1010
1qq7B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.8996 80 115 1.10.150.240
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8915 3 137 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.879 3 137 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8753 5 140 3.40.50.1010
ID Description Score Start End GO Terms
AF-H8Z488-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9925 1 141 GO:0000287
GO:0004540
GO:0090729
AF-A0A6N8EFV6-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.992 1 141 GO:0000287
GO:0004540
GO:0090729
AF-I4G9J5-F1-model_v4 PIN domain-containing protein 0.9909 1 139 GO:0004518
GO:0046872
AF-A0A2C6VAU1-F1-model_v4 deleted 0.9907 1 138
AF-B2IWE4-F1-model_v4 PilT protein domain protein 0.9898 3 139 GO:0004518
GO:0046872

Map