F180335

General Info

Members Datasets Scaffolds Average Seq Length
140 35 280 193

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0000528|Ga0453683_0000528_5268_5843
Length 191
Sequence MGLKGTKTEKNLLTAFAGESQARNRYTYYATKAKAEGFVQIADIFEETANQEREHAKRLFKFLEGGEAEISAAFPAGVFGAPTTANLKAAAAGEHYEQTEMYPGFAATAREEGFSEIAAVFMAIAVAERQHEKRYLDLLANIENDRVFQRVEPVVWRCRNCGYLHEANGAPDVCPACAHARAHFEILGENW

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
3 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
4 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
5 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
6 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
7 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
8 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
9 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
10 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
11 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
12 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
13 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
14 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
15 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
16 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
17 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
18 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
19 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
26 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
27 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
28 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
29 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
30 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
31 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
32 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
33 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
34 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
35 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70
Metatranscriptomes 30
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 9.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0000528 3300044673 Bacteria 42795
2 Ga0265323_10013213 3300028653 Bacteria 3297
3 Ga0265323_10015471 3300028653 Bacteria 3000
4 Ga0265322_10001234 3300028654 Bacteria 8700
5 Ga0265322_10015699 3300028654 Bacteria 2187
6 Ga0265338_10003612 3300028800 Bacteria 21587
7 Ga0265332_10007735 3300031238 Bacteria 4854
8 Ga0265328_10113723 3300031239 Unclassified 1007
9 Ga0265329_10114068 3300031242 Unclassified 864
10 Ga0265339_10003384 3300031249 Bacteria 11160
11 Ga0265316_10001095 3300031344 Bacteria 29347
12 Ga0265316_10055565 3300031344 Bacteria 3095
13 Ga0265316_10080990 3300031344 Bacteria 2489
14 Ga0316579_10417877 3300031691 Bacteria 649
15 Ga0265314_10281077 3300031711 Unclassified 941
16 Ga0265342_10000027 3300031712 Bacteria 158835
17 Ga0265342_10033717 3300031712 Bacteria 3145
18 Ga0265342_10055864 3300031712 Bacteria 2342
19 Ga0316576_10002650 3300031727 Bacteria 10220
20 Ga0316576_10012047 3300031727 Bacteria 5698
21 Ga0316576_10096124 3300031727 Bacteria 2211
22 Ga0316576_10224850 3300031727 Bacteria 1411
23 Ga0316576_10588324 3300031727 Bacteria 813
24 Ga0316578_10000854 3300031728 Bacteria 11438
25 Ga0316578_10020660 3300031728 Bacteria 3642
26 Ga0316578_10301966 3300031728 Bacteria 957
27 Ga0316577_10003960 3300031733 Bacteria 7574
28 Ga0316577_10009999 3300031733 Bacteria 5115
29 Ga0316577_10073301 3300031733 Bacteria 1912
30 Ga0316577_10239025 3300031733 Bacteria 1027
31 Ga0316577_10325135 3300031733 Bacteria 872
32 Ga0316583_10005165 3300032133 Bacteria 4680
33 Ga0316583_10113475 3300032133 Bacteria 945
34 Ga0316583_10117253 3300032133 Bacteria 928
35 Ga0316585_10000144 3300032137 Bacteria 13977
36 Ga0316585_10009568 3300032137 Bacteria 2833
37 Ga0316580_10017676 3300032139 Bacteria 2194
38 Ga0316580_10063922 3300032139 Bacteria 1129
39 Ga0316593_10001031 3300032168 Bacteria 5784
40 Ga0316593_10003901 3300032168 Bacteria 3759
41 Ga0316593_10006425 3300032168 Bacteria 3170
42 Ga0316593_10007134 3300032168 Bacteria 3055
43 Ga0316593_10007429 3300032168 Bacteria 3012
44 Ga0316593_10008381 3300032168 Unclassified 2880
45 Ga0316593_10017171 3300032168 Unclassified 2204
46 Ga0316593_10017610 3300032168 Bacteria 2182
47 Ga0316593_10017717 3300032168 Unclassified 2176
48 Ga0316593_10019106 3300032168 Bacteria 2114
49 Ga0316593_10024209 3300032168 Bacteria 1923
50 Ga0316593_10026515 3300032168 Bacteria 1854
51 Ga0316593_10032210 3300032168 Bacteria 1712
52 Ga0316593_10033115 3300032168 Bacteria 1691
53 Ga0316593_10036200 3300032168 Bacteria 1626
54 Ga0316593_10053369 3300032168 Bacteria 1369
55 Ga0316593_10111277 3300032168 Bacteria 978
56 Ga0316593_10148798 3300032168 Bacteria 851
57 Ga0316593_10227889 3300032168 Bacteria 693
58 Ga0316592_1001629 3300033524 Bacteria 3687
59 Ga0316592_1002249 3300033524 Bacteria 3303
60 Ga0316592_1002966 3300033524 Bacteria 2998
61 Ga0316592_1003950 3300033524 Bacteria 2721
62 Ga0316592_1004028 3300033524 Bacteria 2703
63 Ga0316592_1004054 3300033524 Bacteria 2697
64 Ga0316592_1014698 3300033524 Unclassified 1625
65 Ga0316592_1019068 3300033524 Bacteria 1449
66 Ga0316592_1021188 3300033524 Bacteria 1384
67 Ga0316592_1021727 3300033524 Bacteria 1368
68 Ga0316592_1024869 3300033524 Bacteria 1289
69 Ga0316592_1026174 3300033524 Bacteria 1259
70 Ga0316592_1051340 3300033524 Bacteria 921
71 Ga0316586_1000290 3300033527 Bacteria 4555
72 Ga0316588_1008002 3300033528 Bacteria 2163
73 Ga0316588_1033060 3300033528 Unclassified 1219
74 Ga0316588_1080099 3300033528 Bacteria 808
75 Ga0316587_1002958 3300033529 Bacteria 2329
76 Ga0316587_1004644 3300033529 Bacteria 2009
77 Ga0316596_1010955 3300033541 Bacteria 2206
78 Ga0316596_1024622 3300033541 Bacteria 1546
79 Ga0316596_1062890 3300033541 Bacteria 991
80 Ga0316596_1145467 3300033541 Bacteria 650
81 Ga0316574_0019523 3300035398 Bacteria 4000
82 Ga0316574_0138658 3300035398 Bacteria 1566
83 Ga0316574_0454659 3300035398 Bacteria 802
84 Ga0316582_0000567 3300036647 Bacteria 14250
85 Ga0316582_0019331 3300036647 Bacteria 3985
86 Ga0316582_0031124 3300036647 Bacteria 3258
87 Ga0316582_0062604 3300036647 Bacteria 2389
88 Ga0316582_0165758 3300036647 Unclassified 1498
89 Ga0316582_0182615 3300036647 Bacteria 1428
90 Ga0316582_0235540 3300036647 Bacteria 1253
91 Ga0316582_0326655 3300036647 Bacteria 1055
92 Ga0316582_0537832 3300036647 Unclassified 805
93 Ga0316584_0000939 3300036712 Bacteria 16603
94 Ga0316584_0002301 3300036712 Bacteria 12022
95 Ga0316584_0003202 3300036712 Bacteria 10596
96 Ga0316584_0043326 3300036712 Bacteria 3356
97 Ga0316584_0072336 3300036712 Bacteria 2584
98 Ga0316584_0091595 3300036712 Bacteria 2276
99 Ga0316584_0807805 3300036712 Bacteria 637
100 Ga0316581_0006687 3300037588 Unclassified 3064
101 Ga0316581_0008030 3300037588 Bacteria 2855
102 Ga0400484_34304 3300038725 Bacteria 1018
103 Ga0400488_45572 3300038741 Bacteria 4325
104 Ga0400483_010960 3300039062 Bacteria 7568
105 Ga0400483_171337 3300039062 Bacteria 14586
106 Ga0400483_175230 3300039062 Bacteria 1725
107 Ga0400483_283450 3300039062 Bacteria 5882
108 Ga0400489_69549 3300039093 Bacteria 14785
109 Ga0451577_0110326 3300042876 Bacteria 2461
110 Ga0451577_0118048 3300042876 Bacteria 2376
111 Ga0451577_0120184 3300042876 Bacteria 2353
112 Ga0451577_0620302 3300042876 Bacteria 981
113 Ga0453683_0000168 3300044673 Bacteria 91041
114 Ga0453683_0011040 3300044673 Bacteria 5971
115 Ga0453683_0011681 3300044673 Bacteria 5785
116 Ga0453683_0036670 3300044673 Bacteria 3085
117 Ga0453683_0170317 3300044673 Bacteria 1379
118 Ga0453683_0308005 3300044673 Bacteria 1014
119 Ga0453683_0543841 3300044673 Bacteria 755
120 Ga0453684_0000361 3300044712 Bacteria 188097
121 Ga0453684_0003445 3300044712 Bacteria 35638
122 Ga0453684_0013891 3300044712 Bacteria 12989
123 Ga0453684_0016071 3300044712 Bacteria 11748
124 Ga0453684_0034093 3300044712 Bacteria 7076
125 Ga0453684_0038472 3300044712 Bacteria 6539
126 Ga0453684_0066849 3300044712 Bacteria 4575
127 Ga0453684_0070980 3300044712 Unclassified 4407
128 Ga0453684_0076714 3300044712 Bacteria 4194
129 Ga0453684_0146234 3300044712 Bacteria 2815
130 Ga0453684_0258499 3300044712 Bacteria 1996
131 Ga0453684_0340304 3300044712 Bacteria 1694
132 Ga0453684_0376450 3300044712 Unclassified 1595
133 Ga0453684_0809722 3300044712 Bacteria 1010
134 Ga0453684_0823594 3300044712 Bacteria 999
135 Ga0451576_0000011 3300045051 Bacteria 676436
136 Ga0451576_0000432 3300045051 Bacteria 96361
137 Ga0451576_0047082 3300045051 Bacteria 4536
138 Ga0451576_0224670 3300045051 Bacteria 1961
139 Ga0451576_0504259 3300045051 Bacteria 1271
140 Ga0451576_1250267 3300045051 Bacteria 775
141 Ga0453683_0000528
142 Ga0265323_10013213
143 Ga0265323_10015471
144 Ga0265322_10001234
145 Ga0265322_10015699
146 Ga0265338_10003612
147 Ga0265332_10007735
148 Ga0265328_10113723
149 Ga0265329_10114068
150 Ga0265339_10003384
151 Ga0265316_10001095
152 Ga0265316_10055565
153 Ga0265316_10080990
154 Ga0316579_10417877
155 Ga0265314_10281077
156 Ga0265342_10000027
157 Ga0265342_10033717
158 Ga0265342_10055864
159 Ga0316576_10002650
160 Ga0316576_10012047
161 Ga0316576_10096124
162 Ga0316576_10224850
163 Ga0316576_10588324
164 Ga0316578_10000854
165 Ga0316578_10020660
166 Ga0316578_10301966
167 Ga0316577_10003960
168 Ga0316577_10009999
169 Ga0316577_10073301
170 Ga0316577_10239025
171 Ga0316577_10325135
172 Ga0316583_10005165
173 Ga0316583_10113475
174 Ga0316583_10117253
175 Ga0316585_10000144
176 Ga0316585_10009568
177 Ga0316580_10017676
178 Ga0316580_10063922
179 Ga0316593_10001031
180 Ga0316593_10003901
181 Ga0316593_10006425
182 Ga0316593_10007134
183 Ga0316593_10007429
184 Ga0316593_10008381
185 Ga0316593_10017171
186 Ga0316593_10017610
187 Ga0316593_10017717
188 Ga0316593_10019106
189 Ga0316593_10024209
190 Ga0316593_10026515
191 Ga0316593_10032210
192 Ga0316593_10033115
193 Ga0316593_10036200
194 Ga0316593_10053369
195 Ga0316593_10111277
196 Ga0316593_10148798
197 Ga0316593_10227889
198 Ga0316592_1001629
199 Ga0316592_1002249
200 Ga0316592_1002966
201 Ga0316592_1003950
202 Ga0316592_1004028
203 Ga0316592_1004054
204 Ga0316592_1014698
205 Ga0316592_1019068
206 Ga0316592_1021188
207 Ga0316592_1021727
208 Ga0316592_1024869
209 Ga0316592_1026174
210 Ga0316592_1051340
211 Ga0316586_1000290
212 Ga0316588_1008002
213 Ga0316588_1033060
214 Ga0316588_1080099
215 Ga0316587_1002958
216 Ga0316587_1004644
217 Ga0316596_1010955
218 Ga0316596_1024622
219 Ga0316596_1062890
220 Ga0316596_1145467
221 Ga0316574_0019523
222 Ga0316574_0138658
223 Ga0316574_0454659
224 Ga0316582_0000567
225 Ga0316582_0019331
226 Ga0316582_0031124
227 Ga0316582_0062604
228 Ga0316582_0165758
229 Ga0316582_0182615
230 Ga0316582_0235540
231 Ga0316582_0326655
232 Ga0316582_0537832
233 Ga0316584_0000939
234 Ga0316584_0002301
235 Ga0316584_0003202
236 Ga0316584_0043326
237 Ga0316584_0072336
238 Ga0316584_0091595
239 Ga0316584_0807805
240 Ga0316581_0006687
241 Ga0316581_0008030
242 Ga0400484_34304
243 Ga0400488_45572
244 Ga0400483_010960
245 Ga0400483_171337
246 Ga0400483_175230
247 Ga0400483_283450
248 Ga0400489_69549
249 Ga0451577_0110326
250 Ga0451577_0118048
251 Ga0451577_0120184
252 Ga0451577_0620302
253 Ga0453683_0000168
254 Ga0453683_0011040
255 Ga0453683_0011681
256 Ga0453683_0036670
257 Ga0453683_0170317
258 Ga0453683_0308005
259 Ga0453683_0543841
260 Ga0453684_0000361
261 Ga0453684_0003445
262 Ga0453684_0013891
263 Ga0453684_0016071
264 Ga0453684_0034093
265 Ga0453684_0038472
266 Ga0453684_0066849
267 Ga0453684_0070980
268 Ga0453684_0076714
269 Ga0453684_0146234
270 Ga0453684_0258499
271 Ga0453684_0340304
272 Ga0453684_0376450
273 Ga0453684_0809722
274 Ga0453684_0823594
275 Ga0451576_0000011
276 Ga0451576_0000432
277 Ga0451576_0047082
278 Ga0451576_0224670
279 Ga0451576_0504259
280 Ga0451576_1250267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21349

RUBY_RBDX

Rubrerythrin, rubredoxin-like domain

156

185

0.99

PF02915

Rubrerythrin

Rubrerythrin

10

139

0.94

PF00210

Ferritin

Ferritin-like domain

9

145

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b71-assembly1.cif.gz_A rubrerythrin 0.9816 3 192
1b71-assembly1.cif.gz_A rubrerythrin 0.9715 3 192
6zw6-assembly1.cif.gz_A c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.9196 85 146
6e8g-assembly1.cif.gz_T cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution 0.9106 85 148
8sqp-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (apo, f16l mutant) 0.8768 9 145
ID Description Score Start End Superfamily
1jybA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9948 3 146 1.20.1260.10
1dvbA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9947 3 146 1.20.1260.10
af_Q58156_13_77_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9926 85 141 1.20.1260.10
1jybA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9812 3 146 1.20.1260.10
1dvbA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9811 3 146 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A842YFJ4-F1-model_v4 Demethoxyubiquinone hydroxylase family protein 1.002 3 114 GO:0016491
GO:0046872
AF-A0A7V0KIN1-F1-model_v4 Rubrerythrin family protein 1.002 3 94 GO:0016491
GO:0046872
AF-X1VCF3-F1-model_v4 Ferritin-like diiron domain-containing protein 1.001 3 81 GO:0016491
GO:0046872
AF-A0A151BFQ1-F1-model_v4 Rubrerythrin 0.9993 3 138 GO:0016491
GO:0046872
AF-A0A2H6FRR6-F1-model_v4 Rubrerythrin 0.9939 1 97 GO:0016491
GO:0046872

Map