F179565

General Info

Members Datasets Scaffolds Average Seq Length
140 109 128 271

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10000074|Ga0163162_1000007410
Length 304
Sequence MDDIGLLIAKNRKKRVRFTANQFYCLKRMIVSILGCGWYGKALAKELLQKGIIVKGSATSVEKLDALKGLGTSPFTVQVNADEINYDIDFFKCDVLVISIPPGLKKGEGSSYLPKLNHIIQAIIQNNIPKVIYISSTGVYGDHNKIVAENDDPKPDSESGKILLYAESLFKSESNFKATIIRFAGLVGPGRHPGRFFAGKKDVPNGLAPVNMIHLDDCVGIGSAIIEQEAFGHLFNACSPDHPAKEDFYKDAALKGGYEAPQFIHELNTWKIIESVNLKPMLNYTFKIQNWKDCAFDPLPQSSN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
5 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
8 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
9 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
10 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
107 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
108 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
109 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.43
Metatranscriptomes 0
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.71
Rhizosphere 81.43
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10003099 3300001990 Bacteria 5889
2 JGI24743J22301_10005775 3300001991 Bacteria 2080
3 JGI24735J21928_10000013 3300002067 Bacteria 208663
4 JGI25162J39368_1000094 3300002737 Bacteria 98697
5 rootH1_10001050 3300003316 Bacteria 47333
6 rootH2_10004991 3300003320 Bacteria 34166
7 rootL2_10159200 3300003322 Bacteria 4239
8 rootH1_10031203 3300003323 Bacteria 5671
9 rootH1_10048629 3300003323 Bacteria 8845
10 rootH1_10307393 3300003323 Bacteria 1806
11 Ga0065704_10126131 3300005289 Bacteria 1685
12 Ga0070676_10000144 3300005328 Bacteria 27905
13 Ga0070683_100369454 3300005329 Bacteria 1366
14 Ga0070660_100039119 3300005339 Bacteria 3604
15 Ga0070671_100073895 3300005355 Bacteria 2848
16 Ga0070673_100001562 3300005364 Bacteria 13484
17 Ga0070659_100005950 3300005366 Bacteria 8794
18 Ga0070678_100022252 3300005456 Bacteria 4196
19 Ga0068867_100010471 3300005459 Bacteria 6544
20 Ga0070684_100022850 3300005535 Bacteria 5221
21 Ga0068853_100036340 3300005539 Bacteria 4188
22 Ga0070665_100000267 3300005548 Bacteria 85526
23 Ga0068855_100031144 3300005563 Bacteria 6371
24 Ga0068852_100004913 3300005616 Bacteria 9492
25 Ga0068866_10364186 3300005718 Bacteria 922
26 Ga0075366_10000333 3300006195 Bacteria 21671
27 Ga0097621_100000344 3300006237 Bacteria 31894
28 Ga0068871_100000824 3300006358 Bacteria 20776
29 Ga0068865_100000492 3300006881 Bacteria 22165
30 Ga0105240_10004820 3300009093 Bacteria 20332
31 Ga0105240_10112235 3300009093 Bacteria 3296
32 Ga0105240_10135302 3300009093 Bacteria 2952
33 Ga0105245_10398403 3300009098 Bacteria 1375
34 Ga0105243_10027581 3300009148 Unclassified 4352
35 Ga0105241_10007925 3300009174 Bacteria 7810
36 Ga0105237_10000168 3300009545 Bacteria 92212
37 Ga0105237_10024456 3300009545 Bacteria 6178
38 Ga0105238_10003025 3300009551 Bacteria 16777
39 Ga0105239_10000139 3300010375 Bacteria 102090
40 Ga0105239_10001948 3300010375 Bacteria 26930
41 Ga0105239_10007943 3300010375 Bacteria 12127
42 Ga0105239_10023559 3300010375 Bacteria 6781
43 Ga0105239_10153749 3300010375 Bacteria 2568
44 Ga0157373_10000327 3300013100 Bacteria 38493
45 Ga0157371_10004224 3300013102 Bacteria 12634
46 Ga0157371_10016028 3300013102 Bacteria 5604
47 Ga0157370_10038320 3300013104 Bacteria 4637
48 Ga0157370_10077170 3300013104 Unclassified 3139
49 Ga0157369_10139934 3300013105 Bacteria 2561
50 Ga0157369_10164085 3300013105 Bacteria 2344
51 Ga0157374_10000029 3300013296 Bacteria 211547
52 Ga0157374_10001437 3300013296 Bacteria 20134
53 Ga0157378_10115671 3300013297 Bacteria 2465
54 Ga0163162_10000074 3300013306 Bacteria 91138
55 Ga0157372_10000980 3300013307 Bacteria 31160
56 Ga0157372_10011878 3300013307 Bacteria 9279
57 Ga0157372_10063545 3300013307 Bacteria 4140
58 Ga0157372_10212354 3300013307 Bacteria 2243
59 Ga0157375_10029531 3300013308 Bacteria 5158
60 Ga0157375_10423675 3300013308 Bacteria 1497
61 Ga0157377_10135363 3300014745 Bacteria 1509
62 Ga0157376_10329666 3300014969 Bacteria 1454
63 Ga0163161_10349768 3300017792 Bacteria 1174
64 Ga0213872_10013632 3300021361 Bacteria 3806
65 Ga0209437_100077 3300025233 Bacteria 286656
66 Ga0209026_1000246 3300025250 Bacteria 69164
67 Ga0209026_1022865 3300025250 Bacteria 955
68 Ga0209129_1011017 3300025258 Unclassified 2196
69 Ga0209455_1007738 3300025272 Bacteria 2995
70 Ga0207645_10000185 3300025907 Bacteria 49988
71 Ga0207705_10381034 3300025909 Bacteria 1089
72 Ga0207654_10113508 3300025911 Bacteria 1689
73 Ga0207695_10007354 3300025913 Bacteria 14053
74 Ga0207695_10174219 3300025913 Bacteria 2074
75 Ga0207695_10221556 3300025913 Bacteria 1799
76 Ga0207695_10334344 3300025913 Bacteria 1403
77 Ga0207671_10001374 3300025914 Bacteria 28328
78 Ga0207671_10010536 3300025914 Bacteria 7615
79 Ga0207657_10144793 3300025919 Bacteria 1939
80 Ga0207687_10444631 3300025927 Bacteria 1074
81 Ga0207690_10003100 3300025932 Bacteria 10007
82 Ga0207704_10000055 3300025938 Bacteria 78858
83 Ga0207661_10326971 3300025944 Bacteria 1379
84 Ga0207667_10107551 3300025949 Bacteria 2878
85 Ga0207667_10518137 3300025949 Bacteria 1208
86 Ga0207651_10237173 3300025960 Bacteria 1484
87 Ga0207677_10003225 3300026023 Bacteria 8610
88 Ga0207639_10217550 3300026041 Bacteria 1648
89 Ga0207648_10000775 3300026089 Bacteria 36025
90 Ga0207683_10033313 3300026121 Bacteria 4475
91 Ga0207698_10007539 3300026142 Bacteria 6819
92 Ga0268266_10000018 3300028379 Bacteria 569141
93 Ga0307517_10010105 3300028786 Bacteria 13262
94 Ga0265338_10031018 3300028800 Bacteria 5250
95 Ga0307509_10346774 3300031507 Unclassified 1210
96 Ga0307408_100001788 3300031548 Bacteria 15705
97 Ga0307414_10000671 3300032004 Bacteria 17507
98 Ga0307414_10281710 3300032004 Unclassified 1397
99 Ga0307414_10503061 3300032004 Bacteria 1072
100 Ga0307510_10003612 3300033180 Bacteria 18058
101 Ga0395899_0001160 3300037312 Bacteria 23301
102 Ga0395900_0001549 3300037418 Bacteria 27320
103 Ga0395898_0027333 3300037466 Bacteria 5730
104 Ga0395905_0003309 3300037471 Bacteria 17296
105 Ga0395901_0003411 3300038443 Bacteria 16009
106 Ga0436361_0136843 3300039447 Bacteria 3863
107 Ga0451833_0776800 3300041491 Bacteria 990
108 Ga0495583_0026550 3300046506 Bacteria 2868
109 Ga0495606_0000035 3300046507 Bacteria 243820
110 Ga0495606_0084540 3300046507 Bacteria 1965
111 Ga0495606_0110188 3300046507 Bacteria 1662
112 Ga0495610_0001310 3300046512 Bacteria 22164
113 Ga0495648_0074204 3300046524 Bacteria 1961
114 Ga0495652_0143695 3300046529 Bacteria 1873
115 Ga0495633_0004472 3300046558 Bacteria 8874
116 Ga0495625_0000063 3300046660 Bacteria 176435
117 Ga0495625_0296827 3300046660 Unclassified 1035
118 Ga0495661_0004990 3300046665 Bacteria 9477
119 Ga0495661_0110093 3300046665 Bacteria 1536
120 Ga0495649_0000006 3300046694 Bacteria 542188
121 Ga0495683_0040801 3300047323 Bacteria 2344
122 Ga0495683_0070363 3300047323 Bacteria 1718
123 Ga0495686_0000113 3300047472 Bacteria 168307
124 Ga0495686_0001789 3300047472 Bacteria 21805
125 Ga0501241_000654 3300049758 Bacteria 7448
126 Ga0500651_0009341 3300053093 Bacteria 5818
127 Ga0500608_000639 3300053122 Bacteria 12919
128 Ga0500618_000006 3300053125 Bacteria 239188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10349768 Ga0163161_103497682 242
2 3300046660 Ga0495625_0296827 Ga0495625_0296827_146_967 244
3 3300003316 rootH1_10001050 rootH1_100010505 256
4 3300013296 Ga0157374_10000029 Ga0157374_1000002915 258
5 iso_pu_bacteria 2884933994 2884937914 258
6 iso_pu_bacteria 2919437846 2919438548 258
7 3300005329 Ga0070683_100369454 Ga0070683_1003694542 259
8 3300005366 Ga0070659_100005950 Ga0070659_1000059508 259
9 3300005535 Ga0070684_100022850 Ga0070684_1000228504 259
10 3300013100 Ga0157373_10000327 Ga0157373_100003275 259
11 3300013102 Ga0157371_10004224 Ga0157371_100042249 259
12 3300013105 Ga0157369_10164085 Ga0157369_101640852 259
13 3300013307 Ga0157372_10000980 Ga0157372_1000098022 259
14 3300025250 Ga0209026_1000246 Ga0209026_100024634 259
15 3300025932 Ga0207690_10003100 Ga0207690_100031005 259
16 3300025944 Ga0207661_10326971 Ga0207661_103269712 259
17 3300005563 Ga0068855_100031144 Ga0068855_1000311441 260
18 3300009093 Ga0105240_10004820 Ga0105240_1000482012 260
19 3300025909 Ga0207705_10381034 Ga0207705_103810341 260
20 3300025913 Ga0207695_10007354 Ga0207695_100073544 260
21 3300025949 Ga0207667_10107551 Ga0207667_101075512 260
22 iso_pu_bacteria 2775506987 2776613110 260
23 3300006195 Ga0075366_10000333 Ga0075366_1000033319 261
24 3300014745 Ga0157377_10135363 Ga0157377_101353631 261
25 3300028786 Ga0307517_10010105 Ga0307517_100101052 261
26 iso_pu_bacteria 2919186247 2919187311 261
27 iso_pu_bacteria 2939664404 2939665420 261
28 3300001991 JGI24743J22301_10005775 JGI24743J22301_100057752 262
29 3300003320 rootH2_10004991 rootH2_1000499123 262
30 3300003322 rootL2_10159200 rootL2_101592004 262
31 3300003323 rootH1_10031203 rootH1_100312036 262
32 3300003323 rootH1_10048629 rootH1_1004862910 262
33 3300003323 rootH1_10307393 rootH1_103073931 262
34 3300005328 Ga0070676_10000144 Ga0070676_1000014417 262
35 3300005339 Ga0070660_100039119 Ga0070660_1000391194 262
36 3300005355 Ga0070671_100073895 Ga0070671_1000738952 262
37 3300005364 Ga0070673_100001562 Ga0070673_10000156210 262
38 3300005456 Ga0070678_100022252 Ga0070678_1000222522 262
39 3300005459 Ga0068867_100010471 Ga0068867_1000104714 262
40 3300005539 Ga0068853_100036340 Ga0068853_1000363402 262
41 3300005548 Ga0070665_100000267 Ga0070665_10000026763 262
42 3300005616 Ga0068852_100004913 Ga0068852_1000049133 262
43 3300005718 Ga0068866_10364186 Ga0068866_103641861 262
44 3300006237 Ga0097621_100000344 Ga0097621_10000034431 262
45 3300006358 Ga0068871_100000824 Ga0068871_10000082411 262
46 3300006881 Ga0068865_100000492 Ga0068865_10000049210 262
47 3300009093 Ga0105240_10112235 Ga0105240_101122353 262
48 3300009093 Ga0105240_10135302 Ga0105240_101353022 262
49 3300009098 Ga0105245_10398403 Ga0105245_103984031 262
50 3300009148 Ga0105243_10027581 Ga0105243_100275813 262
51 3300009174 Ga0105241_10007925 Ga0105241_100079254 262
52 3300009545 Ga0105237_10000168 Ga0105237_100001689 262
53 3300009551 Ga0105238_10003025 Ga0105238_100030258 262
54 3300010375 Ga0105239_10000139 Ga0105239_1000013963 262
55 3300010375 Ga0105239_10001948 Ga0105239_1000194816 262
56 3300010375 Ga0105239_10023559 Ga0105239_100235592 262
57 3300013296 Ga0157374_10001437 Ga0157374_100014379 262
58 3300013297 Ga0157378_10115671 Ga0157378_101156711 262
59 3300013307 Ga0157372_10212354 Ga0157372_102123542 262
60 3300013308 Ga0157375_10029531 Ga0157375_100295313 262
61 3300013308 Ga0157375_10423675 Ga0157375_104236752 262
62 3300014969 Ga0157376_10329666 Ga0157376_103296662 262
63 3300021361 Ga0213872_10013632 Ga0213872_100136322 262
64 3300025272 Ga0209455_1007738 Ga0209455_10077384 262
65 3300025907 Ga0207645_10000185 Ga0207645_1000018532 262
66 3300025911 Ga0207654_10113508 Ga0207654_101135081 262
67 3300025913 Ga0207695_10174219 Ga0207695_101742192 262
68 3300025913 Ga0207695_10221556 Ga0207695_102215562 262
69 3300025914 Ga0207671_10010536 Ga0207671_100105368 262
70 3300025919 Ga0207657_10144793 Ga0207657_101447932 262
71 3300025927 Ga0207687_10444631 Ga0207687_104446311 262
72 3300025938 Ga0207704_10000055 Ga0207704_1000005511 262
73 3300025960 Ga0207651_10237173 Ga0207651_102371732 262
74 3300026023 Ga0207677_10003225 Ga0207677_100032252 262
75 3300026041 Ga0207639_10217550 Ga0207639_102175502 262
76 3300026089 Ga0207648_10000775 Ga0207648_100007753 262
77 3300026121 Ga0207683_10033313 Ga0207683_100333132 262
78 3300026142 Ga0207698_10007539 Ga0207698_100075396 262
79 3300028379 Ga0268266_10000018 Ga0268266_10000018468 262
80 3300028800 Ga0265338_10031018 Ga0265338_100310183 262
81 3300031507 Ga0307509_10346774 Ga0307509_103467742 262
82 3300032004 Ga0307414_10000671 Ga0307414_1000067111 262
83 3300033180 Ga0307510_10003612 Ga0307510_1000361214 262
84 3300037312 Ga0395899_0001160 Ga0395899_0001160_15645_16451 262
85 3300037418 Ga0395900_0001549 Ga0395900_0001549_1213_2019 262
86 3300037466 Ga0395898_0027333 Ga0395898_0027333_2234_3040 262
87 3300037471 Ga0395905_0003309 Ga0395905_0003309_15314_16120 262
88 3300038443 Ga0395901_0003411 Ga0395901_0003411_11614_12420 262
89 3300039447 Ga0436361_0136843 Ga0436361_0136843_384_1190 262
90 3300046529 Ga0495652_0143695 Ga0495652_0143695_218_1027 262
91 3300047323 Ga0495683_0070363 Ga0495683_0070363_389_1189 262
92 3300047472 Ga0495686_0001789 Ga0495686_0001789_20421_21212 262
93 3300053122 Ga0500608_000639 Ga0500608_000639_7124_7936 262
94 iso_pu_bacteria 2599185184 2599480325 262
95 iso_pu_bacteria 2839989709 2839991320 262
96 iso_pu_bacteria 2928078545 2928083424 262
97 iso_pu_bacteria 2928147474 2928151312 262
98 iso_pu_bacteria 2932082852 2932084613 262
99 3300049758 Ga0501241_000654 Ga0501241_000654_2588_3409 263
100 3300005289 Ga0065704_10126131 Ga0065704_101261312 264
101 3300013104 Ga0157370_10038320 Ga0157370_100383202 264
102 3300053093 Ga0500651_0009341 Ga0500651_0009341_1895_2719 264
103 iso_pu_bacteria 2738543023 2739301096 265
104 iso_pu_bacteria 2852627209 2852627266 265
105 3300001990 JGI24737J22298_10003099 JGI24737J22298_100030994 266
106 3300002067 JGI24735J21928_10000013 JGI24735J21928_1000001358 266
107 3300002737 JGI25162J39368_1000094 JGI25162J39368_100009411 266
108 3300009545 Ga0105237_10024456 Ga0105237_100244566 266
109 3300010375 Ga0105239_10007943 Ga0105239_100079439 266
110 3300010375 Ga0105239_10153749 Ga0105239_101537493 266
111 3300013102 Ga0157371_10016028 Ga0157371_100160283 266
112 3300013104 Ga0157370_10077170 Ga0157370_100771703 266
113 3300013105 Ga0157369_10139934 Ga0157369_101399343 266
114 3300013306 Ga0163162_10000074 Ga0163162_1000007410 266
115 3300013307 Ga0157372_10011878 Ga0157372_100118782 266
116 3300013307 Ga0157372_10063545 Ga0157372_100635453 266
117 3300025233 Ga0209437_100077 Ga0209437_100077235 266
118 3300025250 Ga0209026_1022865 Ga0209026_10228652 266
119 3300025258 Ga0209129_1011017 Ga0209129_10110173 266
120 3300025913 Ga0207695_10334344 Ga0207695_103343441 266
121 3300025914 Ga0207671_10001374 Ga0207671_100013746 266
122 3300025949 Ga0207667_10518137 Ga0207667_105181372 266
123 3300031548 Ga0307408_100001788 Ga0307408_1000017885 266
124 3300032004 Ga0307414_10281710 Ga0307414_102817102 266
125 3300032004 Ga0307414_10503061 Ga0307414_105030611 266
126 3300041491 Ga0451833_0776800 Ga0451833_0776800_148_969 266
127 3300046506 Ga0495583_0026550 Ga0495583_0026550_1325_2125 266
128 3300046507 Ga0495606_0000035 Ga0495606_0000035_21586_22386 266
129 3300046507 Ga0495606_0084540 Ga0495606_0084540_1090_1908 266
130 3300046507 Ga0495606_0110188 Ga0495606_0110188_673_1479 266
131 3300046512 Ga0495610_0001310 Ga0495610_0001310_12980_13873 266
132 3300046524 Ga0495648_0074204 Ga0495648_0074204_732_1532 266
133 3300046558 Ga0495633_0004472 Ga0495633_0004472_7323_8216 266
134 3300046660 Ga0495625_0000063 Ga0495625_0000063_4831_5631 266
135 3300046665 Ga0495661_0004990 Ga0495661_0004990_6290_7090 266
136 3300046665 Ga0495661_0110093 Ga0495661_0110093_558_1451 266
137 3300046694 Ga0495649_0000006 Ga0495649_0000006_191888_192688 266
138 3300047323 Ga0495683_0040801 Ga0495683_0040801_189_1082 266
139 3300047472 Ga0495686_0000113 Ga0495686_0000113_155564_156370 266
140 3300053125 Ga0500618_000006 Ga0500618_000006_7629_8456 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

115

220

0.84

PF13460

NAD_binding_10

NAD(P)H-binding

35

210

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6neu-assembly2.cif.gz_A fad-dependent monooxygenase tropb from t. stipitatus r206q variant 0.9462 4 37
3inr-assembly1.cif.gz_B structure of udp-galactopyranose mutase bound to udp-galactose (oxidized) 0.9439 4 33
3int-assembly3.cif.gz_B structure of udp-galactopyranose mutase bound to udp-galactose (reduced) 0.9408 4 33
6net-assembly2.cif.gz_A fad-dependent monooxygenase tropb from t. stipitatus substrate complex 0.9406 4 37
3gf4-assembly1.cif.gz_A structure of udp-galactopyranose mutase bound to udp-glucose 0.9366 4 33
ID Description Score Start End Superfamily
af_P0AD12_1_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 5 263 3.40.50.720
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9307 4 48 3.40.50.2300
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9204 5 33 3.50.50.60
af_P49086_94_556_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9194 4 37 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9175 4 37 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2H9VVN2-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9934 5 263 GO:0004029
GO:0005737
AF-A0A519ME60-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9889 57 264 GO:0004029
GO:0005737
AF-A0A1Q3UJF5-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9856 5 264 GO:0004029
GO:0005737
AF-A0A2H9VVN2-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9821 5 263 GO:0004029
GO:0005737
AF-A0A2U2PHJ7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9761 2 264 GO:0004029
GO:0005737

Feature Viewer

pLDDT pTM Quality
94.11 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map