F179091

General Info

Members Datasets Scaffolds Average Seq Length
140 97 140 400

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10016991|Ga0070717_100169913
Length 420
Sequence MEFFKHSDFDFLGKKWPFIILSLILTAAGFISLGIKGGPRYGIDFRGGALITISFANRPPVDKVRAALSGKLPVEVQEVSGRPEDIIGIDAQQDAALQASRQKMIDSLDAAFGQPSNGKYNINSGGAAALADHLRDGLAAASVAMSDPQLQTLASNIMDYRKQHSGLIKSLDELASVPGVTPQVLNVIKQQTYPDSVSVVGTEVVGPKIGAELQRKAILAVLYALGGMLVYIAFRFEWIYGAAAVIAVFHDTLITIGLFSLFNKEITLTVVAALLTLVGYSMNDTIVTFDRIRENLKILRREELEPLINKSVNQTLSRTVLTSGLTLLTALALFFFGGQVLNGFAFALVCGIIVGTYSSVFVASPILIFWHNFLEGRKRSARGGGPLVASRKTPNTPLPAAAKVSAGSKDRARPGAAKVK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
11 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
12 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
22 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
26 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
73 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
74 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.71
Metatranscriptomes 9.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 21.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100067449 3300005329 Bacteria 3332
2 Ga0070714_100046360 3300005435 Bacteria 3687
3 Ga0070711_100077164 3300005439 Bacteria 2364
4 Ga0070708_100195909 3300005445 Bacteria 1890
5 Ga0070663_100203618 3300005455 Bacteria 1546
6 Ga0070681_10397365 3300005458 Bacteria 1290
7 Ga0070679_100008088 3300005530 Bacteria 9886
8 Ga0068859_100223184 3300005617 Bacteria 1972
9 Ga0070717_10014889 3300006028 Bacteria 5987
10 Ga0070717_10016991 3300006028 Bacteria 5652
11 Ga0070716_100130521 3300006173 Bacteria 1588
12 Ga0070712_100203418 3300006175 Bacteria 1557
13 Ga0097620_100223179 3300006931 Bacteria 1972
14 Ga0105240_10023603 3300009093 Bacteria 8126
15 Ga0105245_10407310 3300009098 Unclassified 1360
16 Ga0114129_10019753 3300009147 Bacteria 9589
17 Ga0105242_10119800 3300009176 Bacteria 2256
18 Ga0105248_10047688 3300009177 Bacteria 4804
19 Ga0157370_10011694 3300013104 Bacteria 9161
20 Ga0157370_10180419 3300013104 Bacteria 1962
21 Ga0157369_10312830 3300013105 Bacteria 1633
22 Ga0157374_10116595 3300013296 Bacteria 2573
23 Ga0163162_10297287 3300013306 Unclassified 1746
24 Ga0197907_10489426 3300020069 Bacteria 3962
25 Ga0206356_10015317 3300020070 Bacteria 5552
26 Ga0206349_1160118 3300020075 Bacteria 3671
27 Ga0206355_1693635 3300020076 Bacteria 1744
28 Ga0206350_10008103 3300020080 Bacteria 1540
29 Ga0206353_11316969 3300020082 Bacteria 1452
30 Ga0213873_10001545 3300021358 Bacteria 3844
31 Ga0213872_10000293 3300021361 Bacteria 42523
32 Ga0213876_10004508 3300021384 Bacteria 7781
33 Ga0213876_10008106 3300021384 Bacteria 5693
34 Ga0213876_10042039 3300021384 Bacteria 2415
35 Ga0213875_10000005 3300021388 Bacteria 595146
36 Ga0213875_10001070 3300021388 Bacteria 19185
37 Ga0213875_10008529 3300021388 Bacteria 5242
38 Ga0213875_10008908 3300021388 Bacteria 5115
39 Ga0213875_10013208 3300021388 Bacteria 4061
40 Ga0213875_10048281 3300021388 Bacteria 1997
41 Ga0213875_10092648 3300021388 Bacteria 1409
42 Ga0224712_10001687 3300022467 Bacteria 5226
43 Ga0224712_10001767 3300022467 Bacteria 5151
44 Ga0224712_10003982 3300022467 Bacteria 3924
45 Ga0224712_10033604 3300022467 Bacteria 1879
46 Ga0228598_1000007 3300024227 Bacteria 28688
47 Ga0207699_10098636 3300025906 Bacteria 1849
48 Ga0207695_10110646 3300025913 Bacteria 2727
49 Ga0207693_10056197 3300025915 Bacteria 3086
50 Ga0207693_10123981 3300025915 Bacteria 2030
51 Ga0207663_10019498 3300025916 Bacteria 3822
52 Ga0207652_10049051 3300025921 Bacteria 3612
53 Ga0207664_10168718 3300025929 Bacteria 1871
54 Ga0207686_10055644 3300025934 Bacteria 2483
55 Ga0207665_10054380 3300025939 Bacteria 2699
56 Ga0207711_10018624 3300025941 Bacteria 5773
57 Ga0207711_10071728 3300025941 Bacteria 3006
58 Ga0207678_10228694 3300026067 Bacteria 1592
59 Ga0207702_10020707 3300026078 Bacteria 5440
60 Ga0207702_10219579 3300026078 Bacteria 1771
61 Ga0268266_10208881 3300028379 Unclassified 1790
62 Ga0265338_10015040 3300028800 Bacteria 8541
63 Ga0265324_10024837 3300029957 Bacteria 2127
64 Ga0265762_1009782 3300030760 Bacteria 1711
65 Ga0265760_10000003 3300031090 Bacteria 152662
66 Ga0265760_10012269 3300031090 Bacteria 2449
67 Ga0265320_10002898 3300031240 Bacteria 11763
68 Ga0265325_10008933 3300031241 Bacteria 5886
69 Ga0265340_10033417 3300031247 Bacteria 2560
70 Ga0265331_10005003 3300031250 Bacteria 8133
71 Ga0265331_10029605 3300031250 Bacteria 2731
72 Ga0265316_10001597 3300031344 Bacteria 24155
73 Ga0265316_10018494 3300031344 Bacteria 5985
74 Ga0265316_10101829 3300031344 Bacteria 2182
75 Ga0265313_10055002 3300031595 Bacteria 1887
76 Ga0265314_10027765 3300031711 Bacteria 4231
77 Ga0265342_10008733 3300031712 Bacteria 7227
78 Ga0373935_0044807 3300035692 Bacteria 2790
79 Ga0373927_0045995 3300035695 Bacteria 2824
80 Ga0373933_0000039 3300035724 Bacteria 80657
81 Ga0373937_0000072 3300036401 Bacteria 92459
82 Ga0436364_0157811 3300037853 Bacteria 430293
83 Ga0436364_0272415 3300037853 Bacteria 13475
84 Ga0436364_0327697 3300037853 Bacteria 5326
85 Ga0436364_0438548 3300037853 Bacteria 48773
86 Ga0436364_0699008 3300037853 Bacteria 7438
87 Ga0436364_0745657 3300037853 Bacteria 51254
88 Ga0436364_0763185 3300037853 Bacteria 5788
89 Ga0436364_0881068 3300037853 Bacteria 3984
90 Ga0436364_0903752 3300037853 Bacteria 2038
91 Ga0436364_0958769 3300037853 Bacteria 4228
92 Ga0436364_1264757 3300037853 Bacteria 1815
93 Ga0436364_1276699 3300037853 Bacteria 2758
94 Ga0436365_0603602 3300039437 Unclassified 2328
95 Ga0436365_0749206 3300039437 Bacteria 2591
96 Ga0436365_0986976 3300039437 Bacteria 3393
97 Ga0436365_1539624 3300039437 Bacteria 7470
98 Ga0436365_1593052 3300039437 Bacteria 9779
99 Ga0436361_0474393 3300039447 Bacteria 166415
100 Ga0436363_0967077 3300039450 Bacteria 8810
101 Ga0436363_0978302 3300039450 Unclassified 1543
102 Ga0436362_0186103 3300039453 Unclassified 4654
103 Ga0436362_0195120 3300039453 Bacteria 1642
104 Ga0451577_0154245 3300042876 Bacteria 2067
105 Ga0453684_0291714 3300044712 Bacteria 1857
106 Ga0495580_0004054 3300046472 Bacteria 12360
107 Ga0495652_0124419 3300046529 Unclassified 2051
108 Ga0495587_0023875 3300046536 Bacteria 3754
109 Ga0495684_0020298 3300047471 Bacteria 5120
110 Ga0495602_0000183 3300048088 Bacteria 58980
111 Ga0496126_0084864 3300048929 Bacteria 2793
112 Ga0501031_0109852 3300049568 Bacteria 1800
113 Ga0501032_0028198 3300049569 Bacteria 3858
114 Ga0501034_0007772 3300049571 Bacteria 11408
115 Ga0501034_0044904 3300049571 Bacteria 4466
116 Ga0501036_0000348 3300049572 Bacteria 32585
117 Ga0501037_0000531 3300049573 Bacteria 30438
118 Ga0501039_0037458 3300049575 Bacteria 3743
119 Ga0501043_0000174 3300049579 Bacteria 57374
120 Ga0501043_0022368 3300049579 Bacteria 4960
121 Ga0501046_0039780 3300049580 Bacteria 3762
122 Ga0501047_0011660 3300049581 Bacteria 8309
123 Ga0501047_0015813 3300049581 Bacteria 7191
124 Ga0501048_0182568 3300049582 Bacteria 1487
125 Ga0501067_0003933 3300049583 Bacteria 8202
126 Ga0501068_0005732 3300049584 Bacteria 6807
127 Ga0501070_0005799 3300049586 Bacteria 10537
128 Ga0501072_0000291 3300049588 Bacteria 35610
129 Ga0501073_0009106 3300049589 Bacteria 7326
130 Ga0501074_0001522 3300049590 Bacteria 15670
131 Ga0501077_0007956 3300049593 Bacteria 6552
132 Ga0501079_0001158 3300049741 Bacteria 18452
133 Ga0501080_0000011 3300049742 Bacteria 113928
134 Ga0501083_0020565 3300049744 Bacteria 4590
135 Ga0501035_0028061 3300049822 Bacteria 5140
136 Ga0501044_0008074 3300049823 Bacteria 11562
137 Ga0501044_0013245 3300049823 Bacteria 8928
138 Ga0501044_0013342 3300049823 Bacteria 8890
139 Ga0501044_0023577 3300049823 Bacteria 6544
140 Ga0501084_0003832 3300054114 Bacteria 12236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100195909 Ga0070708_1001959092 299
2 3300044712 Ga0453684_0291714 Ga0453684_0291714_52_1224 343
3 3300005617 Ga0068859_100223184 Ga0068859_1002231841 348
4 3300006931 Ga0097620_100223179 Ga0097620_1002231792 348
5 3300009177 Ga0105248_10047688 Ga0105248_100476882 348
6 3300009147 Ga0114129_10019753 Ga0114129_100197534 349
7 3300025941 Ga0207711_10018624 Ga0207711_100186244 349
8 3300031344 Ga0265316_10001597 Ga0265316_1000159720 366
9 3300037853 Ga0436364_0272415 Ga0436364_0272415_6014_7297 368
10 3300009093 Ga0105240_10023603 Ga0105240_100236035 369
11 3300009176 Ga0105242_10119800 Ga0105242_101198002 369
12 3300013104 Ga0157370_10180419 Ga0157370_101804192 369
13 3300013296 Ga0157374_10116595 Ga0157374_101165952 369
14 3300025913 Ga0207695_10110646 Ga0207695_101106462 369
15 3300025934 Ga0207686_10055644 Ga0207686_100556442 369
16 3300021358 Ga0213873_10001545 Ga0213873_100015454 371
17 3300021384 Ga0213876_10008106 Ga0213876_100081065 371
18 3300039437 Ga0436365_0749206 Ga0436365_0749206_1179_2411 371
19 3300039450 Ga0436363_0967077 Ga0436363_0967077_2864_4096 371
20 3300039453 Ga0436362_0186103 Ga0436362_0186103_1019_2251 371
21 3300035692 Ga0373935_0044807 Ga0373935_0044807_1104_2324 372
22 3300042876 Ga0451577_0154245 Ga0451577_0154245_502_1674 372
23 3300020069 Ga0197907_10489426 Ga0197907_104894265 373
24 3300020076 Ga0206355_1693635 Ga0206355_16936352 373
25 3300020080 Ga0206350_10008103 Ga0206350_100081031 373
26 3300022467 Ga0224712_10033604 Ga0224712_100336042 373
27 3300005455 Ga0070663_100203618 Ga0070663_1002036181 374
28 3300013105 Ga0157369_10312830 Ga0157369_103128301 374
29 3300021384 Ga0213876_10042039 Ga0213876_100420392 374
30 3300021388 Ga0213875_10008908 Ga0213875_100089082 374
31 3300022467 Ga0224712_10001687 Ga0224712_100016877 374
32 3300026067 Ga0207678_10228694 Ga0207678_102286942 374
33 3300026078 Ga0207702_10219579 Ga0207702_102195792 374
34 3300037853 Ga0436364_0699008 Ga0436364_0699008_5077_6312 374
35 3300039437 Ga0436365_0986976 Ga0436365_0986976_880_2115 374
36 3300013306 Ga0163162_10297287 Ga0163162_102972871 375
37 3300030760 Ga0265762_1009782 Ga0265762_10097822 375
38 3300005439 Ga0070711_100077164 Ga0070711_1000771642 376
39 3300006028 Ga0070717_10016991 Ga0070717_100169913 376
40 3300006175 Ga0070712_100203418 Ga0070712_1002034182 376
41 3300025906 Ga0207699_10098636 Ga0207699_100986361 376
42 3300025915 Ga0207693_10123981 Ga0207693_101239811 376
43 3300025916 Ga0207663_10019498 Ga0207663_100194983 376
44 3300035695 Ga0373927_0045995 Ga0373927_0045995_346_1578 376
45 3300046472 Ga0495580_0004054 Ga0495580_0004054_1334_2566 376
46 3300047471 Ga0495684_0020298 Ga0495684_0020298_2801_4033 376
47 3300009098 Ga0105245_10407310 Ga0105245_104073101 377
48 3300031090 Ga0265760_10000003 Ga0265760_1000000369 377
49 3300039437 Ga0436365_1593052 Ga0436365_1593052_3966_5201 377
50 3300049568 Ga0501031_0109852 Ga0501031_0109852_258_1457 377
51 3300049569 Ga0501032_0028198 Ga0501032_0028198_148_1347 377
52 3300049571 Ga0501034_0007772 Ga0501034_0007772_6897_8096 377
53 3300049572 Ga0501036_0000348 Ga0501036_0000348_30858_32057 377
54 3300049573 Ga0501037_0000531 Ga0501037_0000531_2822_4021 377
55 3300049575 Ga0501039_0037458 Ga0501039_0037458_2397_3596 377
56 3300049579 Ga0501043_0000174 Ga0501043_0000174_25541_26740 377
57 3300049580 Ga0501046_0039780 Ga0501046_0039780_803_2002 377
58 3300049581 Ga0501047_0011660 Ga0501047_0011660_3108_4307 377
59 3300049582 Ga0501048_0182568 Ga0501048_0182568_251_1450 377
60 3300049583 Ga0501067_0003933 Ga0501067_0003933_4778_5977 377
61 3300049584 Ga0501068_0005732 Ga0501068_0005732_1042_2241 377
62 3300049586 Ga0501070_0005799 Ga0501070_0005799_6026_7225 377
63 3300049588 Ga0501072_0000291 Ga0501072_0000291_33457_34656 377
64 3300049589 Ga0501073_0009106 Ga0501073_0009106_2979_4178 377
65 3300049590 Ga0501074_0001522 Ga0501074_0001522_11364_12563 377
66 3300049593 Ga0501077_0007956 Ga0501077_0007956_1363_2562 377
67 3300049741 Ga0501079_0001158 Ga0501079_0001158_11364_12563 377
68 3300049742 Ga0501080_0000011 Ga0501080_0000011_4184_5383 377
69 3300049744 Ga0501083_0020565 Ga0501083_0020565_1291_2490 377
70 3300049823 Ga0501044_0023577 Ga0501044_0023577_2524_3723 377
71 3300054114 Ga0501084_0003832 Ga0501084_0003832_3312_4511 377
72 3300005435 Ga0070714_100046360 Ga0070714_1000463604 378
73 3300006028 Ga0070717_10014889 Ga0070717_100148898 378
74 3300006173 Ga0070716_100130521 Ga0070716_1001305212 378
75 3300021384 Ga0213876_10004508 Ga0213876_100045082 378
76 3300021388 Ga0213875_10000005 Ga0213875_10000005399 378
77 3300021388 Ga0213875_10008529 Ga0213875_100085291 378
78 3300021388 Ga0213875_10048281 Ga0213875_100482811 378
79 3300024227 Ga0228598_1000007 Ga0228598_10000076 378
80 3300025915 Ga0207693_10056197 Ga0207693_100561972 378
81 3300025929 Ga0207664_10168718 Ga0207664_101687182 378
82 3300025939 Ga0207665_10054380 Ga0207665_100543802 378
83 3300031090 Ga0265760_10012269 Ga0265760_100122692 378
84 3300031241 Ga0265325_10008933 Ga0265325_100089333 378
85 3300031250 Ga0265331_10029605 Ga0265331_100296052 378
86 3300031344 Ga0265316_10101829 Ga0265316_101018292 378
87 3300031595 Ga0265313_10055002 Ga0265313_100550021 378
88 3300035724 Ga0373933_0000039 Ga0373933_0000039_48381_49616 378
89 3300036401 Ga0373937_0000072 Ga0373937_0000072_41627_42862 378
90 3300037853 Ga0436364_0157811 Ga0436364_0157811_129924_131141 378
91 3300037853 Ga0436364_0763185 Ga0436364_0763185_3726_4970 378
92 3300037853 Ga0436364_0881068 Ga0436364_0881068_1756_3003 378
93 3300037853 Ga0436364_0903752 Ga0436364_0903752_108_1355 378
94 3300039437 Ga0436365_0603602 Ga0436365_0603602_163_1416 378
95 3300039437 Ga0436365_1539624 Ga0436365_1539624_5710_6957 378
96 3300039450 Ga0436363_0978302 Ga0436363_0978302_156_1409 378
97 3300039453 Ga0436362_0195120 Ga0436362_0195120_249_1496 378
98 3300046529 Ga0495652_0124419 Ga0495652_0124419_721_1956 378
99 3300046536 Ga0495587_0023875 Ga0495587_0023875_2181_3416 378
100 3300048088 Ga0495602_0000183 Ga0495602_0000183_8147_9382 378
101 3300049579 Ga0501043_0022368 Ga0501043_0022368_2208_3398 378
102 3300021388 Ga0213875_10013208 Ga0213875_100132082 379
103 3300022467 Ga0224712_10003982 Ga0224712_100039822 379
104 3300025941 Ga0207711_10071728 Ga0207711_100717282 379
105 3300026078 Ga0207702_10020707 Ga0207702_100207074 379
106 3300028379 Ga0268266_10208881 Ga0268266_102088812 379
107 3300037853 Ga0436364_0438548 Ga0436364_0438548_41024_42232 379
108 3300037853 Ga0436364_0958769 Ga0436364_0958769_2539_3774 379
109 3300021361 Ga0213872_10000293 Ga0213872_1000029312 380
110 3300028800 Ga0265338_10015040 Ga0265338_100150404 380
111 3300029957 Ga0265324_10024837 Ga0265324_100248372 380
112 3300031240 Ga0265320_10002898 Ga0265320_100028987 380
113 3300031247 Ga0265340_10033417 Ga0265340_100334172 380
114 3300031250 Ga0265331_10005003 Ga0265331_100050034 380
115 3300031344 Ga0265316_10018494 Ga0265316_100184942 380
116 3300031711 Ga0265314_10027765 Ga0265314_100277652 380
117 3300031712 Ga0265342_10008733 Ga0265342_100087337 380
118 3300037853 Ga0436364_1276699 Ga0436364_1276699_1328_2578 380
119 3300039447 Ga0436361_0474393 Ga0436361_0474393_133506_134759 380
120 3300005329 Ga0070683_100067449 Ga0070683_1000674492 381
121 3300005458 Ga0070681_10397365 Ga0070681_103973651 381
122 3300005530 Ga0070679_100008088 Ga0070679_1000080882 381
123 3300013104 Ga0157370_10011694 Ga0157370_100116948 381
124 3300020070 Ga0206356_10015317 Ga0206356_100153172 381
125 3300020075 Ga0206349_1160118 Ga0206349_11601184 381
126 3300020082 Ga0206353_11316969 Ga0206353_113169692 381
127 3300021388 Ga0213875_10001070 Ga0213875_100010705 381
128 3300021388 Ga0213875_10092648 Ga0213875_100926481 381
129 3300022467 Ga0224712_10001767 Ga0224712_100017676 381
130 3300025921 Ga0207652_10049051 Ga0207652_100490514 381
131 3300037853 Ga0436364_0327697 Ga0436364_0327697_514_1773 381
132 3300037853 Ga0436364_0745657 Ga0436364_0745657_49930_51174 381
133 3300037853 Ga0436364_1264757 Ga0436364_1264757_244_1494 381
134 3300048929 Ga0496126_0084864 Ga0496126_0084864_252_1451 381
135 3300049571 Ga0501034_0044904 Ga0501034_0044904_150_1349 381
136 3300049581 Ga0501047_0015813 Ga0501047_0015813_3231_4430 381
137 3300049822 Ga0501035_0028061 Ga0501035_0028061_34_1233 381
138 3300049823 Ga0501044_0008074 Ga0501044_0008074_1793_2992 381
139 3300049823 Ga0501044_0013245 Ga0501044_0013245_1086_2285 381
140 3300049823 Ga0501044_0013342 Ga0501044_0013342_249_1448 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02355

SecD_SecF

Protein export membrane protein

184

373

0.96

PF07549

Sec_GG

SecD/SecF GG Motif

31

57

0.84

Feature Viewer

pLDDT pTM Quality
64.66 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map