F178865

General Info

Members Datasets Scaffolds Average Seq Length
140 96 280 71

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100498241|Ga0070699_1004982412
Length 78
Sequence VVPIKLMNRLIGLFVIVGGICLVAIGFLIYSGGFNWFGKLPGDIHYESDRVQVYIPIVSMLIVSLALSLIFYLIRRFF

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
62 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
67 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
95 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
96 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.71
Rhizosphere 98.57
Stem 0
Stem Tuber 0
Unclassified 37.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100498241 3300005518 Bacteria 1106
2 Ga0070690_101717683 3300005330 Unclassified 510
3 Ga0070687_100648611 3300005343 Unclassified 731
4 Ga0070669_101568907 3300005353 Bacteria 573
5 Ga0070675_101503473 3300005354 Bacteria 621
6 Ga0070703_10054999 3300005406 Bacteria 1284
7 Ga0070701_10126177 3300005438 Unclassified 1448
8 Ga0070708_100006709 3300005445 Bacteria 9165
9 Ga0070708_100114693 3300005445 Unclassified 2479
10 Ga0070708_100432249 3300005445 Unclassified 1242
11 Ga0070662_100148094 3300005457 Bacteria 1825
12 Ga0068867_101984830 3300005459 Unclassified 550
13 Ga0070706_100074830 3300005467 Unclassified 3134
14 Ga0070706_100196684 3300005467 Bacteria 1883
15 Ga0070706_101099727 3300005467 Unclassified 732
16 Ga0070707_100158802 3300005468 Bacteria 2202
17 Ga0070707_100486307 3300005468 Unclassified 1196
18 Ga0070707_101299589 3300005468 Bacteria 694
19 Ga0070707_101905784 3300005468 Unclassified 562
20 Ga0070698_100247808 3300005471 Bacteria 1714
21 Ga0070698_100681343 3300005471 Unclassified 970
22 Ga0070699_100454368 3300005518 Archaea 1162
23 Ga0070679_100554285 3300005530 Unclassified 1093
24 Ga0070697_100026906 3300005536 Bacteria 4598
25 Ga0070697_100516637 3300005536 Unclassified 1045
26 Ga0070697_101711330 3300005536 Bacteria 562
27 Ga0070696_101436886 3300005546 Bacteria 589
28 Ga0070704_100448849 3300005549 Bacteria 1110
29 Ga0070704_101258908 3300005549 Unclassified 676
30 Ga0068859_100813506 3300005617 Bacteria 1022
31 Ga0068859_101458739 3300005617 Bacteria 755
32 Ga0068864_101348069 3300005618 Unclassified 714
33 Ga0068861_100911057 3300005719 Bacteria 833
34 Ga0068861_101667081 3300005719 Bacteria 630
35 Ga0068858_101386961 3300005842 Bacteria 692
36 Ga0068862_100960667 3300005844 Unclassified 843
37 Ga0097621_100979523 3300006237 Unclassified 790
38 Ga0075433_11947411 3300006852 Unclassified 504
39 Ga0075434_100192833 3300006871 Bacteria 2058
40 Ga0097620_100813477 3300006931 Bacteria 1022
41 Ga0097620_101458941 3300006931 Bacteria 755
42 Ga0075435_101429687 3300007076 Bacteria 606
43 Ga0099794_10379166 3300007265 Bacteria 737
44 Ga0105240_10027415 3300009093 Bacteria 7456
45 Ga0105240_10742823 3300009093 Bacteria 1067
46 Ga0111539_10707534 3300009094 Bacteria 1173
47 Ga0114129_10853713 3300009147 Unclassified 1157
48 Ga0105241_11685421 3300009174 Unclassified 615
49 Ga0105242_10188208 3300009176 Bacteria 1826
50 Ga0105242_11614739 3300009176 Unclassified 682
51 Ga0105242_12772191 3300009176 Unclassified 540
52 Ga0105248_10184949 3300009177 Bacteria 2348
53 Ga0105248_10590100 3300009177 Bacteria 1254
54 Ga0105248_13247885 3300009177 Bacteria 517
55 Ga0105249_10344149 3300009553 Bacteria 1509
56 Ga0105239_12093139 3300010375 Unclassified 657
57 Ga0157378_10812010 3300013297 Bacteria 962
58 Ga0157378_10843405 3300013297 Unclassified 944
59 Ga0157378_11370573 3300013297 Unclassified 750
60 Ga0163162_10004395 3300013306 Bacteria 13563
61 Ga0163162_12016222 3300013306 Unclassified 661
62 Ga0157377_10922740 3300014745 Bacteria 655
63 Ga0157379_12434605 3300014968 Unclassified 523
64 Ga0157376_11021162 3300014969 Unclassified 850
65 Ga0157376_11053610 3300014969 Unclassified 838
66 Ga0207684_10155904 3300025910 Unclassified 1965
67 Ga0207684_10158219 3300025910 Bacteria 1950
68 Ga0207695_10043252 3300025913 Bacteria 4801
69 Ga0207652_10494379 3300025921 Unclassified 1102
70 Ga0207646_11113276 3300025922 Bacteria 695
71 Ga0207681_11656437 3300025923 Bacteria 535
72 Ga0207650_11327647 3300025925 Unclassified 612
73 Ga0207686_10156712 3300025934 Bacteria 1592
74 Ga0207686_11055536 3300025934 Unclassified 661
75 Ga0207709_11327451 3300025935 Unclassified 595
76 Ga0207711_10681915 3300025941 Bacteria 958
77 Ga0207711_11393334 3300025941 Unclassified 643
78 Ga0207675_100770885 3300026118 Bacteria 974
79 Ga0207675_100785977 3300026118 Bacteria 964
80 Ga0207675_101754959 3300026118 Bacteria 640
81 Ga0268266_10505135 3300028379 Bacteria 1155
82 Ga0268264_10951727 3300028381 Unclassified 864
83 Ga0265337_1024853 3300028556 Unclassified 1827
84 Ga0265336_10035644 3300028666 Unclassified 1534
85 Ga0265338_10132787 3300028800 Bacteria 1962
86 Ga0265338_10551560 3300028800 Bacteria 807
87 Ga0265338_10557904 3300028800 Bacteria 801
88 Ga0265324_10265711 3300029957 Bacteria 583
89 Ga0265330_10415110 3300031235 Bacteria 570
90 Ga0265320_10003748 3300031240 Bacteria 10115
91 Ga0265320_10103112 3300031240 Bacteria 1312
92 Ga0265320_10300526 3300031240 Bacteria 710
93 Ga0265320_10394622 3300031240 Bacteria 611
94 Ga0265325_10027011 3300031241 Bacteria 3106
95 Ga0265329_10142552 3300031242 Bacteria 774
96 Ga0373953_0040810 3300035117 Bacteria 1845
97 Ga0373925_1490680 3300037068 Unclassified 554
98 Ga0395900_0439731 3300037418 Bacteria 1262
99 Ga0395901_1247702 3300038443 Unclassified 707
100 Ga0439436_0206382 3300041404 Bacteria 563
101 Ga0451847_0071593 3300041503 Bacteria 830
102 Ga0439462_0095952 3300042015 Bacteria 815
103 Ga0439446_0050254 3300042156 Bacteria 1244
104 Ga0453684_0010963 3300044712 Bacteria 15323
105 Ga0451576_0014255 3300045051 Bacteria 8855
106 Ga0451576_0123287 3300045051 Bacteria 2699
107 Ga0451576_0277933 3300045051 Bacteria 1751
108 Ga0451576_0437419 3300045051 Unclassified 1373
109 Ga0451576_0605164 3300045051 Unclassified 1152
110 Ga0451576_1643521 3300045051 Unclassified 666
111 Ga0451576_2047261 3300045051 Unclassified 589
112 Ga0495580_0777826 3300046472 Bacteria 622
113 Ga0495628_0137535 3300046516 Bacteria 1866
114 Ga0495640_0812467 3300046533 Bacteria 557
115 Ga0495586_0195389 3300046535 Bacteria 1146
116 Ga0495658_0934204 3300046683 Unclassified 554
117 Ga0495613_0831176 3300046689 Bacteria 601
118 Ga0495675_0107144 3300047444 Bacteria 1746
119 Ga0496111_1098953 3300048914 Unclassified 567
120 Ga0501031_0000457 3300049568 Bacteria 23653
121 Ga0501031_0696467 3300049568 Bacteria 652
122 Ga0501033_0009225 3300049570 Bacteria 7596
123 Ga0501033_0405252 3300049570 Bacteria 951
124 Ga0501036_1008795 3300049572 Unclassified 681
125 Ga0501037_0811555 3300049573 Unclassified 617
126 Ga0501038_1234193 3300049574 Unclassified 542
127 Ga0501042_1209050 3300049578 Unclassified 551
128 Ga0501043_0536488 3300049579 Bacteria 871
129 Ga0501077_0169027 3300049593 Unclassified 1389
130 Ga0501035_0034181 3300049822 Bacteria 4621
131 Ga0501044_0000063 3300049823 Bacteria 131090
132 Ga0501044_0043273 3300049823 Bacteria 4679
133 nmdc:mga06r32_2057069_c1 3300050510 Unclassified 504
134 nmdc:mga08y16_206253_c1 3300050511 Bacteria 2036
135 nmdc:mga0n895_1132890_c1 3300050512 Bacteria 758
136 nmdc:mga0n895_648595_c1 3300050512 Bacteria 1055
137 nmdc:mga0rr50_754080_c1 3300050513 Bacteria 831
138 nmdc:mga0a205_1238746_c1 3300050515 Bacteria 594
139 Ga0495601_0156908 3300053077 Bacteria 1486
140 Ga0495655_0003525 3300053083 Archaea 2589
141 Ga0070699_100498241
142 Ga0070690_101717683
143 Ga0070687_100648611
144 Ga0070669_101568907
145 Ga0070675_101503473
146 Ga0070703_10054999
147 Ga0070701_10126177
148 Ga0070708_100006709
149 Ga0070708_100114693
150 Ga0070708_100432249
151 Ga0070662_100148094
152 Ga0068867_101984830
153 Ga0070706_100074830
154 Ga0070706_100196684
155 Ga0070706_101099727
156 Ga0070707_100158802
157 Ga0070707_100486307
158 Ga0070707_101299589
159 Ga0070707_101905784
160 Ga0070698_100247808
161 Ga0070698_100681343
162 Ga0070699_100454368
163 Ga0070679_100554285
164 Ga0070697_100026906
165 Ga0070697_100516637
166 Ga0070697_101711330
167 Ga0070696_101436886
168 Ga0070704_100448849
169 Ga0070704_101258908
170 Ga0068859_100813506
171 Ga0068859_101458739
172 Ga0068864_101348069
173 Ga0068861_100911057
174 Ga0068861_101667081
175 Ga0068858_101386961
176 Ga0068862_100960667
177 Ga0097621_100979523
178 Ga0075433_11947411
179 Ga0075434_100192833
180 Ga0097620_100813477
181 Ga0097620_101458941
182 Ga0075435_101429687
183 Ga0099794_10379166
184 Ga0105240_10027415
185 Ga0105240_10742823
186 Ga0111539_10707534
187 Ga0114129_10853713
188 Ga0105241_11685421
189 Ga0105242_10188208
190 Ga0105242_11614739
191 Ga0105242_12772191
192 Ga0105248_10184949
193 Ga0105248_10590100
194 Ga0105248_13247885
195 Ga0105249_10344149
196 Ga0105239_12093139
197 Ga0157378_10812010
198 Ga0157378_10843405
199 Ga0157378_11370573
200 Ga0163162_10004395
201 Ga0163162_12016222
202 Ga0157377_10922740
203 Ga0157379_12434605
204 Ga0157376_11021162
205 Ga0157376_11053610
206 Ga0207684_10155904
207 Ga0207684_10158219
208 Ga0207695_10043252
209 Ga0207652_10494379
210 Ga0207646_11113276
211 Ga0207681_11656437
212 Ga0207650_11327647
213 Ga0207686_10156712
214 Ga0207686_11055536
215 Ga0207709_11327451
216 Ga0207711_10681915
217 Ga0207711_11393334
218 Ga0207675_100770885
219 Ga0207675_100785977
220 Ga0207675_101754959
221 Ga0268266_10505135
222 Ga0268264_10951727
223 Ga0265337_1024853
224 Ga0265336_10035644
225 Ga0265338_10132787
226 Ga0265338_10551560
227 Ga0265338_10557904
228 Ga0265324_10265711
229 Ga0265330_10415110
230 Ga0265320_10003748
231 Ga0265320_10103112
232 Ga0265320_10300526
233 Ga0265320_10394622
234 Ga0265325_10027011
235 Ga0265329_10142552
236 Ga0373953_0040810
237 Ga0373925_1490680
238 Ga0395900_0439731
239 Ga0395901_1247702
240 Ga0439436_0206382
241 Ga0451847_0071593
242 Ga0439462_0095952
243 Ga0439446_0050254
244 Ga0453684_0010963
245 Ga0451576_0014255
246 Ga0451576_0123287
247 Ga0451576_0277933
248 Ga0451576_0437419
249 Ga0451576_0605164
250 Ga0451576_1643521
251 Ga0451576_2047261
252 Ga0495580_0777826
253 Ga0495628_0137535
254 Ga0495640_0812467
255 Ga0495586_0195389
256 Ga0495658_0934204
257 Ga0495613_0831176
258 Ga0495675_0107144
259 Ga0496111_1098953
260 Ga0501031_0000457
261 Ga0501031_0696467
262 Ga0501033_0009225
263 Ga0501033_0405252
264 Ga0501036_1008795
265 Ga0501037_0811555
266 Ga0501038_1234193
267 Ga0501042_1209050
268 Ga0501043_0536488
269 Ga0501077_0169027
270 Ga0501035_0034181
271 Ga0501044_0000063
272 Ga0501044_0043273
273 nmdc:mga06r32_2057069_c1
274 nmdc:mga08y16_206253_c1
275 nmdc:mga0n895_1132890_c1
276 nmdc:mga0n895_648595_c1
277 nmdc:mga0rr50_754080_c1
278 nmdc:mga0a205_1238746_c1
279 Ga0495601_0156908
280 Ga0495655_0003525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11146

DUF2905

Protein of unknown function (DUF2905)

12

74

0.91

Map