F177669

General Info

Members Datasets Scaffolds Average Seq Length
139 90 278 160

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0285136|Ga0501067_0285136_83_625
Length 180
Sequence VTGPTLGQVKEWFGTLARLVVGGVWLAAGLLKLTDGAASVRAVRAYQLLPEAVVPTVGHALPAFEIVIGLALVAGALTRGAALLSSLLFVAFIVGIASAWARGLQIDCGCFGGGGFDADATSKYPWEIARDSALLLLSLWLVWHPRTRLALDSLIFRPLTPDPERHDHAEQQSDEAHLHG

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
82 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
83 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
84 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
87 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
89 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
90 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.99
Nodule 0
Rhizoplane 8.63
Rhizosphere 71.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0285136 3300049583 Bacteria 919
2 rootH1_10049951 3300003316 Bacteria 1812
3 Ga0070683_100182570 3300005329 Bacteria 1992
4 Ga0070682_100203924 3300005337 Bacteria 1397
5 Ga0070671_100352981 3300005355 Bacteria 1255
6 Ga0070674_100185009 3300005356 Bacteria 1598
7 Ga0070673_100513411 3300005364 Bacteria 1085
8 Ga0070701_10088330 3300005438 Bacteria 1693
9 Ga0070700_100572142 3300005441 Bacteria 881
10 Ga0070663_100286366 3300005455 Bacteria 1315
11 Ga0070678_100357982 3300005456 Bacteria 1257
12 Ga0070685_10263663 3300005466 Bacteria 1147
13 Ga0070664_101104954 3300005564 Bacteria 747
14 Ga0068870_10124908 3300005840 Bacteria 1487
15 Ga0075365_10034736 3300006038 Bacteria 3257
16 Ga0075365_10063715 3300006038 Bacteria 2468
17 Ga0075365_10210399 3300006038 Bacteria 1363
18 Ga0075365_10404512 3300006038 Bacteria 963
19 Ga0075365_10490687 3300006038 Bacteria 868
20 Ga0075363_100014356 3300006048 Bacteria 3867
21 Ga0075363_100022845 3300006048 Bacteria 3165
22 Ga0075363_100064763 3300006048 Bacteria 1975
23 Ga0075364_10044138 3300006051 Bacteria 2898
24 Ga0075367_10066215 3300006178 Bacteria 2164
25 Ga0075367_10168901 3300006178 Bacteria 1362
26 Ga0075370_10002283 3300006353 Bacteria 8844
27 Ga0075370_10123030 3300006353 Bacteria 1511
28 Ga0068865_101435665 3300006881 Bacteria 617
29 Ga0105245_10742884 3300009098 Bacteria 1017
30 Ga0105243_10074307 3300009148 Bacteria 2757
31 Ga0105242_10268494 3300009176 Bacteria 1544
32 Ga0105238_10052778 3300009551 Bacteria 4086
33 Ga0105249_10316248 3300009553 Bacteria 1571
34 Ga0105246_10305972 3300011119 Bacteria 1285
35 Ga0157371_11152064 3300013102 Bacteria 596
36 Ga0157369_10371814 3300013105 Bacteria 1484
37 Ga0157375_10040760 3300013308 Bacteria 4480
38 Ga0163163_10082687 3300014325 Bacteria 3215
39 Ga0157377_10022826 3300014745 Bacteria 3309
40 Ga0163161_10012615 3300017792 Bacteria 5872
41 Ga0207643_10044162 3300025908 Bacteria 2516
42 Ga0207650_10875973 3300025925 Bacteria 762
43 Ga0207659_10117337 3300025926 Bacteria 2034
44 Ga0207691_10047656 3300025940 Bacteria 3932
45 Ga0207668_10774386 3300025972 Bacteria 848
46 Ga0207708_10317634 3300026075 Bacteria 1270
47 Ga0207641_10788138 3300026088 Bacteria 940
48 Ga0207648_10178019 3300026089 Bacteria 1881
49 Ga0207683_10093661 3300026121 Bacteria 2677
50 Ga0209813_10005487 3300027866 Bacteria 3082
51 Ga0307408_100457763 3300031548 Bacteria 1108
52 Ga0307413_10830784 3300031824 Bacteria 779
53 Ga0307409_100308895 3300031995 Bacteria 1475
54 Ga0307409_100578549 3300031995 Bacteria 1107
55 Ga0307416_100371581 3300032002 Bacteria 1456
56 Ga0307416_100534699 3300032002 Bacteria 1243
57 Ga0307414_10231195 3300032004 Bacteria 1525
58 Ga0451797_0829552 3300041453 Bacteria 1009
59 Ga0451797_1058039 3300041453 Bacteria 1039
60 Ga0451853_0792952 3300041512 Bacteria 1245
61 Ga0466965_0012780 3300044683 Bacteria 3953
62 Ga0466965_0029289 3300044683 Bacteria 2679
63 Ga0466965_0090025 3300044683 Bacteria 1560
64 Ga0466966_0028427 3300044684 Bacteria 3643
65 Ga0466966_0572376 3300044684 Bacteria 680
66 Ga0466961_0035498 3300044693 Bacteria 3202
67 Ga0466961_0063425 3300044693 Bacteria 2348
68 Ga0466961_0178503 3300044693 Bacteria 1319
69 Ga0466963_0025261 3300044694 Bacteria 3787
70 Ga0466963_0111577 3300044694 Bacteria 1877
71 Ga0466964_0009515 3300044706 Bacteria 3662
72 Ga0466971_0091456 3300044719 Bacteria 1394
73 Ga0466971_0111336 3300044719 Bacteria 1263
74 Ga0466971_0316617 3300044719 Bacteria 751
75 Ga0466971_0340865 3300044719 Bacteria 724
76 Ga0466970_0033551 3300044765 Bacteria 2713
77 Ga0466970_0064116 3300044765 Bacteria 1970
78 Ga0466970_0176433 3300044765 Bacteria 1185
79 Ga0466970_0517213 3300044765 Bacteria 688
80 Ga0466957_0010440 3300044842 Bacteria 5332
81 Ga0466957_0485966 3300044842 Bacteria 854
82 Ga0466957_0722319 3300044842 Bacteria 704
83 Ga0466960_0017073 3300044901 Bacteria 3159
84 Ga0466960_0018991 3300044901 Bacteria 3021
85 Ga0466960_0058262 3300044901 Bacteria 1886
86 Ga0466960_0201527 3300044901 Bacteria 1087
87 Ga0466960_0402582 3300044901 Bacteria 789
88 Ga0466959_0326136 3300045049 Bacteria 1049
89 Ga0466958_0124590 3300045836 Bacteria 1615
90 Ga0466967_0041538 3300045976 Bacteria 3966
91 Ga0466967_0060953 3300045976 Bacteria 3346
92 Ga0466967_0927381 3300045976 Bacteria 866
93 Ga0495593_0346509 3300047673 Bacteria 742
94 Ga0496100_0605629 3300048903 Bacteria 851
95 Ga0496101_0402682 3300048904 Bacteria 1078
96 Ga0496102_0078460 3300048905 Bacteria 3040
97 Ga0496104_0343774 3300048907 Bacteria 1405
98 Ga0496105_0317965 3300048908 Bacteria 1248
99 Ga0496107_0459779 3300048910 Bacteria 945
100 Ga0496110_0333999 3300048913 Bacteria 1381
101 Ga0496110_0518354 3300048913 Bacteria 1085
102 Ga0496110_1866079 3300048913 Bacteria 511
103 Ga0496114_1350858 3300048917 Bacteria 600
104 Ga0501031_0131513 3300049568 Bacteria 1635
105 Ga0501031_0448879 3300049568 Bacteria 833
106 Ga0501040_0093421 3300049576 Bacteria 2092
107 Ga0501041_0495715 3300049577 Bacteria 777
108 Ga0501043_0346265 3300049579 Bacteria 1130
109 Ga0501048_0106397 3300049582 Bacteria 1980
110 Ga0501067_0024821 3300049583 Bacteria 3324
111 Ga0501067_0069610 3300049583 Bacteria 1948
112 Ga0501068_0038660 3300049584 Bacteria 2859
113 Ga0501069_0064944 3300049585 Bacteria 2040
114 Ga0501069_0153532 3300049585 Bacteria 1324
115 Ga0501069_0274099 3300049585 Bacteria 986
116 Ga0501070_0020148 3300049586 Bacteria 5594
117 Ga0501070_0137874 3300049586 Bacteria 2014
118 Ga0501070_0399080 3300049586 Bacteria 1112
119 Ga0501072_0109311 3300049588 Bacteria 2200
120 Ga0501072_0242077 3300049588 Bacteria 1437
121 Ga0501072_0371050 3300049588 Bacteria 1136
122 Ga0501045_0203004 3300049824 Bacteria 1477
123 nmdc:mga03n38_181366_c1 3300050490 Bacteria 1079
124 nmdc:mga03n38_62065_c1 3300050490 Bacteria 1704
125 nmdc:mga00v17_163521_c1 3300050491 Bacteria 1434
126 nmdc:mga00v17_62187_c1 3300050491 Bacteria 2296
127 nmdc:mga00v17_93923_c1 3300050491 Bacteria 1887
128 nmdc:mga0yw44_427676_c1 3300050492 Bacteria 897
129 nmdc:mga0yw44_459863_c1 3300050492 Bacteria 862
130 nmdc:mga0yw44_504976_c1 3300050492 Bacteria 821
131 nmdc:mga06z11_131003_c1 3300050494 Bacteria 1408
132 nmdc:mga06z11_166913_c1 3300050494 Bacteria 1262
133 Ga0495601_0163891 3300053077 Bacteria 1453
134 Ga0495612_0482049 3300053078 Bacteria 568
135 Ga0500573_0028997 3300053140 Bacteria 3189
136 Ga0501084_1003654 3300054114 Bacteria 701
137 Ga0466962_0011463 3300061719 Bacteria 4268
138 Ga0466962_0493766 3300061719 Bacteria 619
139 2855388866 2855386786 Bacteria 4752232
140 Ga0501067_0285136
141 rootH1_10049951
142 Ga0070683_100182570
143 Ga0070682_100203924
144 Ga0070671_100352981
145 Ga0070674_100185009
146 Ga0070673_100513411
147 Ga0070701_10088330
148 Ga0070700_100572142
149 Ga0070663_100286366
150 Ga0070678_100357982
151 Ga0070685_10263663
152 Ga0070664_101104954
153 Ga0068870_10124908
154 Ga0075365_10034736
155 Ga0075365_10063715
156 Ga0075365_10210399
157 Ga0075365_10404512
158 Ga0075365_10490687
159 Ga0075363_100014356
160 Ga0075363_100022845
161 Ga0075363_100064763
162 Ga0075364_10044138
163 Ga0075367_10066215
164 Ga0075367_10168901
165 Ga0075370_10002283
166 Ga0075370_10123030
167 Ga0068865_101435665
168 Ga0105245_10742884
169 Ga0105243_10074307
170 Ga0105242_10268494
171 Ga0105238_10052778
172 Ga0105249_10316248
173 Ga0105246_10305972
174 Ga0157371_11152064
175 Ga0157369_10371814
176 Ga0157375_10040760
177 Ga0163163_10082687
178 Ga0157377_10022826
179 Ga0163161_10012615
180 Ga0207643_10044162
181 Ga0207650_10875973
182 Ga0207659_10117337
183 Ga0207691_10047656
184 Ga0207668_10774386
185 Ga0207708_10317634
186 Ga0207641_10788138
187 Ga0207648_10178019
188 Ga0207683_10093661
189 Ga0209813_10005487
190 Ga0307408_100457763
191 Ga0307413_10830784
192 Ga0307409_100308895
193 Ga0307409_100578549
194 Ga0307416_100371581
195 Ga0307416_100534699
196 Ga0307414_10231195
197 Ga0451797_0829552
198 Ga0451797_1058039
199 Ga0451853_0792952
200 Ga0466965_0012780
201 Ga0466965_0029289
202 Ga0466965_0090025
203 Ga0466966_0028427
204 Ga0466966_0572376
205 Ga0466961_0035498
206 Ga0466961_0063425
207 Ga0466961_0178503
208 Ga0466963_0025261
209 Ga0466963_0111577
210 Ga0466964_0009515
211 Ga0466971_0091456
212 Ga0466971_0111336
213 Ga0466971_0316617
214 Ga0466971_0340865
215 Ga0466970_0033551
216 Ga0466970_0064116
217 Ga0466970_0176433
218 Ga0466970_0517213
219 Ga0466957_0010440
220 Ga0466957_0485966
221 Ga0466957_0722319
222 Ga0466960_0017073
223 Ga0466960_0018991
224 Ga0466960_0058262
225 Ga0466960_0201527
226 Ga0466960_0402582
227 Ga0466959_0326136
228 Ga0466958_0124590
229 Ga0466967_0041538
230 Ga0466967_0060953
231 Ga0466967_0927381
232 Ga0495593_0346509
233 Ga0496100_0605629
234 Ga0496101_0402682
235 Ga0496102_0078460
236 Ga0496104_0343774
237 Ga0496105_0317965
238 Ga0496107_0459779
239 Ga0496110_0333999
240 Ga0496110_0518354
241 Ga0496110_1866079
242 Ga0496114_1350858
243 Ga0501031_0131513
244 Ga0501031_0448879
245 Ga0501040_0093421
246 Ga0501041_0495715
247 Ga0501043_0346265
248 Ga0501048_0106397
249 Ga0501067_0024821
250 Ga0501067_0069610
251 Ga0501068_0038660
252 Ga0501069_0064944
253 Ga0501069_0153532
254 Ga0501069_0274099
255 Ga0501070_0020148
256 Ga0501070_0137874
257 Ga0501070_0399080
258 Ga0501072_0109311
259 Ga0501072_0242077
260 Ga0501072_0371050
261 Ga0501045_0203004
262 nmdc:mga03n38_181366_c1
263 nmdc:mga03n38_62065_c1
264 nmdc:mga00v17_163521_c1
265 nmdc:mga00v17_62187_c1
266 nmdc:mga00v17_93923_c1
267 nmdc:mga0yw44_427676_c1
268 nmdc:mga0yw44_459863_c1
269 nmdc:mga0yw44_504976_c1
270 nmdc:mga06z11_131003_c1
271 nmdc:mga06z11_166913_c1
272 Ga0495601_0163891
273 Ga0495612_0482049
274 Ga0500573_0028997
275 Ga0501084_1003654
276 Ga0466962_0011463
277 Ga0466962_0493766
278 2855388866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07291

MauE

Methylamine utilisation protein MauE

10

144

0.97

PF07681

DoxX

DoxX

14

99

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5145 2 135
6n63-assembly1.cif.gz_A-2 crystal structure of an iron binding protein 0.5059 5 135
8jj5-assembly1.cif.gz_A porcine uroplakin complex 0.4995 1 90
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.4951 2 135
8p3x-assembly1.cif.gz_F homomeric glua2 flip r/g-edited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 0.4857 1 137
ID Description Score Start End Superfamily
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7674 6 133 1.20.120.550
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7563 6 133 1.20.120.550
af_O74820_11_117_3.40.50.11000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Fe-S cluster assembly protein Dre2, N-terminal domain 0.6854 6 82 3.40.50.11000
5jdhA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6335 1 64 6.10.280.80
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6207 3 138 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7G9RCW5-F1-model_v4 Thioredoxin domain-containing protein 0.9275 1 151 GO:0016020
GO:0030416
AF-A0A7G9RCW5-F1-model_v4 Thioredoxin domain-containing protein 0.9216 1 151 GO:0016020
GO:0030416
AF-A0A2E9NWJ6-F1-model_v4 Methylamine utilization protein MauE 0.9205 1 131 GO:0016020
GO:0030416
AF-A0A4Q4ZNH5-F1-model_v4 DoxX family membrane protein 0.9194 2 150 GO:0016020
GO:0030416
AF-A0A806EHJ8-F1-model_v4 deleted 0.9184 2 147

Map