F177400

General Info

Members Datasets Scaffolds Average Seq Length
139 97 278 68

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0053270|Ga0495621_0053270_512_733
Length 73
Sequence MTDDAMNHQITINGEARSVADSTTLADLVAALGQPPASLATAVNGEFVPRSERAAVQLRDGDAVFTFQPITGG

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
48 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
49 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
50 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
51 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
52 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
53 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
56 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
62 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
63 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
64 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
65 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
66 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
67 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
68 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
71 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
72 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
75 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
76 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
77 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
91 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
92 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.76
Nodule 0
Rhizoplane 0
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0053270 3300046539 Bacteria 1452
2 Ga0055531_10000738 3300003794 Bacteria 27594
3 Ga0070658_10464092 3300005327 Bacteria 1092
4 Ga0070658_11345439 3300005327 Bacteria 620
5 Ga0070658_11546845 3300005327 Bacteria 575
6 Ga0068869_100028792 3300005334 Bacteria 3886
7 Ga0068868_100326962 3300005338 Bacteria 1307
8 Ga0070689_101336498 3300005340 Bacteria 646
9 Ga0070675_101912585 3300005354 Bacteria 547
10 Ga0070674_101054032 3300005356 Bacteria 716
11 Ga0068856_100331772 3300005614 Bacteria 1539
12 Ga0068852_101097579 3300005616 Bacteria 816
13 Ga0068852_101567797 3300005616 Bacteria 681
14 Ga0068851_10250215 3300005834 Bacteria 1005
15 Ga0075365_10193246 3300006038 Bacteria 1425
16 Ga0075363_100400030 3300006048 Bacteria 807
17 Ga0075430_100020895 3300006846 Bacteria 5565
18 Ga0105240_12047307 3300009093 Bacteria 595
19 Ga0105245_10345448 3300009098 Bacteria 1473
20 Ga0105241_10768405 3300009174 Bacteria 885
21 Ga0105239_10514926 3300010375 Bacteria 1361
22 Ga0157374_11175311 3300013296 Bacteria 788
23 Ga0157378_10745821 3300013297 Bacteria 1002
24 Ga0157378_11905000 3300013297 Bacteria 644
25 Ga0157380_10851154 3300014326 Bacteria 934
26 Ga0157380_12126455 3300014326 Bacteria 624
27 Ga0182008_10144567 3300014497 Bacteria 1191
28 Ga0182008_10862881 3300014497 Bacteria 530
29 Ga0182008_10983534 3300014497 Bacteria 502
30 Ga0157376_10004660 3300014969 Bacteria 9558
31 Ga0157376_13026608 3300014969 Bacteria 509
32 Ga0182007_10073700 3300015262 Bacteria 1118
33 Ga0209673_1076193 3300025273 Bacteria 782
34 Ga0209051_1000342 3300025303 Bacteria 70022
35 Ga0209257_1000497 3300025304 Bacteria 70185
36 Ga0207705_10543167 3300025909 Bacteria 903
37 Ga0207654_10377774 3300025911 Bacteria 981
38 Ga0207687_10261199 3300025927 Bacteria 1380
39 Ga0207690_10433194 3300025932 Bacteria 1054
40 Ga0207689_10020329 3300025942 Bacteria 5590
41 Ga0207667_11216854 3300025949 Bacteria 732
42 Ga0207677_10071370 3300026023 Bacteria 2451
43 Ga0207677_10295178 3300026023 Bacteria 1337
44 Ga0207675_102004669 3300026118 Bacteria 596
45 Ga0207698_11020011 3300026142 Bacteria 839
46 Ga0207698_11047650 3300026142 Bacteria 827
47 Ga0307408_100602897 3300031548 Bacteria 976
48 Ga0307408_100681522 3300031548 Bacteria 922
49 Ga0307408_100737221 3300031548 Bacteria 889
50 Ga0307408_101959603 3300031548 Bacteria 563
51 Ga0307412_10128816 3300031911 Bacteria 1835
52 Ga0307412_10790879 3300031911 Bacteria 823
53 Ga0307416_102786780 3300032002 Bacteria 585
54 Ga0307416_103032447 3300032002 Bacteria 562
55 Ga0307416_103266926 3300032002 Bacteria 543
56 Ga0307414_11319125 3300032004 Bacteria 670
57 Ga0307414_12154382 3300032004 Bacteria 521
58 Ga0307415_101582147 3300032126 Bacteria 629
59 Ga0307415_102368340 3300032126 Bacteria 522
60 Ga0395899_0019834 3300037312 Bacteria 5101
61 Ga0395900_0021790 3300037418 Bacteria 6551
62 Ga0395900_0022057 3300037418 Bacteria 6513
63 Ga0395900_0080995 3300037418 Bacteria 3336
64 Ga0395898_0005385 3300037466 Bacteria 13829
65 Ga0395898_0372603 3300037466 Bacteria 1362
66 Ga0395905_0000279 3300037471 Bacteria 75846
67 Ga0395905_0220622 3300037471 Bacteria 1774
68 Ga0395905_0240308 3300037471 Bacteria 1692
69 Ga0395905_0272162 3300037471 Bacteria 1579
70 Ga0395905_0416412 3300037471 Bacteria 1239
71 Ga0395905_0499909 3300037471 Bacteria 1116
72 Ga0395905_1004383 3300037471 Bacteria 737
73 Ga0395905_1417262 3300037471 Bacteria 599
74 Ga0395901_0014263 3300038443 Bacteria 8090
75 Ga0395901_0080761 3300038443 Bacteria 3396
76 Ga0395901_0331381 3300038443 Bacteria 1573
77 Ga0395901_0344874 3300038443 Bacteria 1538
78 Ga0395901_0351328 3300038443 Bacteria 1521
79 Ga0395901_0525955 3300038443 Bacteria 1201
80 Ga0395901_0657619 3300038443 Bacteria 1050
81 Ga0439436_0044746 3300041404 Bacteria 1261
82 Ga0439436_0060920 3300041404 Bacteria 1057
83 Ga0439447_150874 3300041407 Bacteria 535
84 Ga0439453_0155094 3300041408 Bacteria 545
85 Ga0439461_0071944 3300041410 Bacteria 803
86 Ga0439466_0028651 3300041411 Bacteria 1921
87 Ga0439465_0160235 3300041413 Bacteria 807
88 Ga0439431_0029569 3300041997 Bacteria 1354
89 Ga0439433_0186669 3300041999 Bacteria 544
90 Ga0439437_003351 3300042000 Bacteria 1729
91 Ga0439437_059755 3300042000 Bacteria 516
92 Ga0439443_086994 3300042003 Bacteria 586
93 Ga0439449_0000880 3300042007 Bacteria 11731
94 Ga0439450_034921 3300042008 Bacteria 1145
95 Ga0439457_045915 3300042014 Bacteria 977
96 Ga0439462_0005389 3300042015 Bacteria 3153
97 Ga0439462_0068082 3300042015 Bacteria 966
98 Ga0450915_014569 3300042119 Bacteria 585
99 Ga0450888_006983 3300042126 Bacteria 1239
100 Ga0450890_048622 3300042127 Bacteria 643
101 Ga0450897_004533 3300042128 Bacteria 1166
102 Ga0450894_009849 3300042131 Bacteria 1238
103 Ga0450898_003748 3300042134 Bacteria 2201
104 Ga0450899_006853 3300042135 Bacteria 1237
105 Ga0450902_057410 3300042137 Bacteria 671
106 Ga0450903_011376 3300042138 Bacteria 1434
107 Ga0450905_081047 3300042142 Bacteria 564
108 Ga0439446_0088375 3300042156 Bacteria 967
109 Ga0439458_0042217 3300042157 Bacteria 1110
110 Ga0439434_0138580 3300042435 Bacteria 801
111 Ga0439464_0108144 3300042439 Bacteria 849
112 Ga0439460_0034457 3300042461 Bacteria 1460
113 Ga0450916_018259 3300042530 Bacteria 944
114 Ga0450893_0000711 3300042532 Bacteria 4846
115 Ga0450893_0058343 3300042532 Bacteria 733
116 Ga0451577_0199560 3300042876 Bacteria 1806
117 Ga0453683_0006241 3300044673 Bacteria 8196
118 Ga0466965_0297408 3300044683 Bacteria 875
119 Ga0466957_0030399 3300044842 Bacteria 3225
120 Ga0466957_0600679 3300044842 Bacteria 770
121 Ga0466957_0706465 3300044842 Bacteria 712
122 Ga0466957_0930975 3300044842 Bacteria 622
123 Ga0466960_0830584 3300044901 Bacteria 561
124 Ga0466959_0426629 3300045049 Bacteria 900
125 Ga0451576_0017383 3300045051 Bacteria 7907
126 Ga0466958_0525980 3300045836 Bacteria 768
127 Ga0495621_0142033 3300046539 Bacteria 940
128 Ga0495656_0085959 3300046615 Bacteria 1429
129 Ga0495681_0109262 3300047470 Bacteria 1200
130 Ga0495615_0154858 3300048090 Bacteria 684
131 Ga0501034_1405781 3300049571 Bacteria 573
132 Ga0501249_099871 3300049679 Bacteria 694
133 Ga0501263_042704 3300049760 Bacteria 670
134 Ga0501279_075589 3300049775 Bacteria 574
135 Ga0501044_0314065 3300049823 Bacteria 1493
136 nmdc:mga03n38_341514_c1 3300050490 Bacteria 813
137 nmdc:mga0yw44_267251_c1 3300050492 Bacteria 1141
138 nmdc:mga0qj67_71224_c1 3300050509 Bacteria 2774
139 Ga0466962_0256122 3300061719 Bacteria 861
140 Ga0495621_0053270
141 Ga0055531_10000738
142 Ga0070658_10464092
143 Ga0070658_11345439
144 Ga0070658_11546845
145 Ga0068869_100028792
146 Ga0068868_100326962
147 Ga0070689_101336498
148 Ga0070675_101912585
149 Ga0070674_101054032
150 Ga0068856_100331772
151 Ga0068852_101097579
152 Ga0068852_101567797
153 Ga0068851_10250215
154 Ga0075365_10193246
155 Ga0075363_100400030
156 Ga0075430_100020895
157 Ga0105240_12047307
158 Ga0105245_10345448
159 Ga0105241_10768405
160 Ga0105239_10514926
161 Ga0157374_11175311
162 Ga0157378_10745821
163 Ga0157378_11905000
164 Ga0157380_10851154
165 Ga0157380_12126455
166 Ga0182008_10144567
167 Ga0182008_10862881
168 Ga0182008_10983534
169 Ga0157376_10004660
170 Ga0157376_13026608
171 Ga0182007_10073700
172 Ga0209673_1076193
173 Ga0209051_1000342
174 Ga0209257_1000497
175 Ga0207705_10543167
176 Ga0207654_10377774
177 Ga0207687_10261199
178 Ga0207690_10433194
179 Ga0207689_10020329
180 Ga0207667_11216854
181 Ga0207677_10071370
182 Ga0207677_10295178
183 Ga0207675_102004669
184 Ga0207698_11020011
185 Ga0207698_11047650
186 Ga0307408_100602897
187 Ga0307408_100681522
188 Ga0307408_100737221
189 Ga0307408_101959603
190 Ga0307412_10128816
191 Ga0307412_10790879
192 Ga0307416_102786780
193 Ga0307416_103032447
194 Ga0307416_103266926
195 Ga0307414_11319125
196 Ga0307414_12154382
197 Ga0307415_101582147
198 Ga0307415_102368340
199 Ga0395899_0019834
200 Ga0395900_0021790
201 Ga0395900_0022057
202 Ga0395900_0080995
203 Ga0395898_0005385
204 Ga0395898_0372603
205 Ga0395905_0000279
206 Ga0395905_0220622
207 Ga0395905_0240308
208 Ga0395905_0272162
209 Ga0395905_0416412
210 Ga0395905_0499909
211 Ga0395905_1004383
212 Ga0395905_1417262
213 Ga0395901_0014263
214 Ga0395901_0080761
215 Ga0395901_0331381
216 Ga0395901_0344874
217 Ga0395901_0351328
218 Ga0395901_0525955
219 Ga0395901_0657619
220 Ga0439436_0044746
221 Ga0439436_0060920
222 Ga0439447_150874
223 Ga0439453_0155094
224 Ga0439461_0071944
225 Ga0439466_0028651
226 Ga0439465_0160235
227 Ga0439431_0029569
228 Ga0439433_0186669
229 Ga0439437_003351
230 Ga0439437_059755
231 Ga0439443_086994
232 Ga0439449_0000880
233 Ga0439450_034921
234 Ga0439457_045915
235 Ga0439462_0005389
236 Ga0439462_0068082
237 Ga0450915_014569
238 Ga0450888_006983
239 Ga0450890_048622
240 Ga0450897_004533
241 Ga0450894_009849
242 Ga0450898_003748
243 Ga0450899_006853
244 Ga0450902_057410
245 Ga0450903_011376
246 Ga0450905_081047
247 Ga0439446_0088375
248 Ga0439458_0042217
249 Ga0439434_0138580
250 Ga0439464_0108144
251 Ga0439460_0034457
252 Ga0450916_018259
253 Ga0450893_0000711
254 Ga0450893_0058343
255 Ga0451577_0199560
256 Ga0453683_0006241
257 Ga0466965_0297408
258 Ga0466957_0030399
259 Ga0466957_0600679
260 Ga0466957_0706465
261 Ga0466957_0930975
262 Ga0466960_0830584
263 Ga0466959_0426629
264 Ga0451576_0017383
265 Ga0466958_0525980
266 Ga0495621_0142033
267 Ga0495656_0085959
268 Ga0495681_0109262
269 Ga0495615_0154858
270 Ga0501034_1405781
271 Ga0501249_099871
272 Ga0501263_042704
273 Ga0501279_075589
274 Ga0501044_0314065
275 nmdc:mga03n38_341514_c1
276 nmdc:mga0yw44_267251_c1
277 nmdc:mga0qj67_71224_c1
278 Ga0466962_0256122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

10

73

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.9162 3 68
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.9035 3 68
3cwi-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137 0.8922 3 68
2lek-assembly1.cif.gz_A solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 0.8913 3 68
1tyg-assembly1.cif.gz_G-2 structure of the thiazole synthase/this complex 0.867 4 65
ID Description Score Start End Superfamily
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9123 5 68 3.10.20.30
2lekA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8913 3 68 3.10.20.30
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8867 5 68 3.10.20.30
1tygG00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.867 4 65 3.10.20.30
3cwiA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8627 5 68 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A4Z0BMQ0-F1-model_v4 Sulfur carrier protein ThiS 0.986 3 68
AF-A0A839LLY5-F1-model_v4 Sulfur carrier protein ThiS 0.9824 2 68
AF-A0A2S0MGI4-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9795 1 68
AF-A0A517N1J3-F1-model_v4 Sulfur carrier protein ThiS 0.9787 1 68
AF-A0A5P9CN12-F1-model_v4 Sulfur carrier protein ThiS 0.9781 1 68

Map