F176403

General Info

Members Datasets Scaffolds Average Seq Length
139 116 278 339

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10036982|Ga0157376_100369823
Length 377
Sequence MKALQLTSWGKPAELREVSPPKPGPGQVVIEIAAAGVCHSDLHLMDWPAGQLPWRLPFTLGHENAGWICELGAGVTGFAIGDAVLVYGPWGCGRCEPCRLGRENYCDRAAEIPAAGGGLGLDGGMAEYMLVPSARLLVPIGDLDPIKAAPLADAALTPYHAIATSRDRLVPGATAVVIGAGGLGQMAIQLLKQTTGANVIAIDTDLGKLETARRFRADHCVPVGHDPGATATVVRTLANGGAQVVFDFVGSEATLALGAKALRAEGKLVIVGLAGGALPVSFFALPYGAQVATSYWGTVTELMELVALARDSRIELAVEAFTLDEAMSAYDKLRRGALRGRAVVVPSRSDRLRIDDGERGRRGRIGAQRDAVDSATD

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
59 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
77 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
116 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 14.39
Rhizosphere 79.86
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10036982 3300014969 Bacteria 3958
2 JGI25406J46586_10004403 3300003203 Bacteria 6559
3 Ga0070683_100155324 3300005329 Bacteria 2170
4 Ga0070666_10058926 3300005335 Bacteria 2597
5 Ga0068868_100035404 3300005338 Bacteria 3859
6 Ga0070668_100032661 3300005347 Bacteria 3961
7 Ga0070667_100000714 3300005367 Bacteria 31992
8 Ga0070713_100087947 3300005436 Bacteria 2666
9 Ga0070710_10000005 3300005437 Bacteria 238049
10 Ga0070663_100184110 3300005455 Bacteria 1622
11 Ga0070706_100020845 3300005467 Bacteria 6035
12 Ga0070707_100044827 3300005468 Bacteria 4234
13 Ga0070698_100281403 3300005471 Unclassified 1595
14 Ga0068853_100014872 3300005539 Bacteria 6390
15 Ga0070665_100195405 3300005548 Bacteria 2024
16 Ga0068857_100225127 3300005577 Bacteria 1714
17 Ga0068856_100299200 3300005614 Bacteria 1626
18 Ga0070702_100142421 3300005615 Bacteria 1529
19 Ga0068861_100017633 3300005719 Bacteria 5074
20 Ga0068860_100055614 3300005843 Bacteria 3762
21 Ga0068862_100003205 3300005844 Bacteria 14175
22 Ga0081455_10008505 3300005937 Bacteria 10663
23 Ga0081455_10087544 3300005937 Bacteria 2534
24 Ga0081538_10000285 3300005981 Bacteria 57944
25 Ga0081538_10000731 3300005981 Bacteria 35867
26 Ga0081538_10002258 3300005981 Bacteria 19086
27 Ga0081539_10007034 3300005985 Bacteria 10426
28 Ga0075364_10022410 3300006051 Bacteria 3988
29 Ga0075428_100007303 3300006844 Bacteria 12241
30 Ga0075428_100367151 3300006844 Bacteria 1544
31 Ga0075431_100132276 3300006847 Bacteria 2573
32 Ga0099794_10150383 3300007265 Bacteria 1181
33 Ga0111539_10002891 3300009094 Bacteria 22802
34 Ga0105245_10000095 3300009098 Bacteria 85212
35 Ga0105245_10347602 3300009098 Bacteria 1468
36 Ga0114129_10010145 3300009147 Bacteria 13429
37 Ga0114129_10627546 3300009147 Bacteria 1389
38 Ga0105243_10026247 3300009148 Bacteria 4458
39 Ga0105242_10057204 3300009176 Bacteria 3192
40 Ga0105238_10347242 3300009551 Bacteria 1472
41 Ga0105249_10001446 3300009553 Bacteria 20789
42 Ga0163162_10015149 3300013306 Bacteria 7530
43 Ga0163163_10247372 3300014325 Bacteria 1833
44 Ga0157379_10010239 3300014968 Bacteria 8165
45 Ga0213875_10017086 3300021388 Bacteria 3511
46 Ga0207692_10000003 3300025898 Bacteria 431531
47 Ga0207687_10000829 3300025927 Bacteria 20889
48 Ga0207687_10027782 3300025927 Bacteria 3798
49 Ga0207700_10053872 3300025928 Bacteria 3017
50 Ga0207644_10186943 3300025931 Bacteria 1627
51 Ga0207706_10075330 3300025933 Bacteria 2967
52 Ga0207686_10052641 3300025934 Bacteria 2542
53 Ga0207686_10190092 3300025934 Bacteria 1463
54 Ga0207709_10011270 3300025935 Bacteria 4931
55 Ga0207668_10002606 3300025972 Bacteria 10545
56 Ga0207658_10008267 3300025986 Bacteria 7089
57 Ga0207708_10230998 3300026075 Bacteria 1485
58 Ga0207674_10075958 3300026116 Bacteria 3369
59 Ga0207675_100023912 3300026118 Bacteria 5681
60 Ga0207428_10006686 3300027907 Bacteria 10591
61 Ga0268266_10028495 3300028379 Bacteria 4746
62 Ga0268265_10013252 3300028380 Bacteria 5602
63 Ga0265338_10218093 3300028800 Bacteria 1427
64 Ga0265330_10016040 3300031235 Bacteria 3461
65 Ga0265329_10015444 3300031242 Unclassified 2667
66 Ga0316575_10086348 3300031665 Unclassified 1268
67 Ga0316579_10040319 3300031691 Bacteria 2164
68 Ga0316576_10006209 3300031727 Bacteria 7415
69 Ga0316576_10019318 3300031727 Bacteria 4667
70 Ga0316576_10114596 3300031727 Bacteria 2022
71 Ga0316578_10026189 3300031728 Bacteria 3286
72 Ga0307405_10030298 3300031731 Bacteria 3172
73 Ga0316577_10016020 3300031733 Bacteria 4126
74 Ga0307407_10189120 3300031903 Bacteria 1371
75 Ga0307409_100273880 3300031995 Bacteria 1556
76 Ga0307416_100023872 3300032002 Bacteria 4449
77 Ga0316585_10006300 3300032137 Bacteria 3388
78 Ga0316580_10014558 3300032139 Bacteria 2401
79 Ga0316574_0001443 3300035398 Bacteria 11282
80 Ga0316574_0073239 3300035398 Bacteria 2165
81 Ga0316582_0068493 3300036647 Bacteria 2292
82 Ga0316582_0085998 3300036647 Bacteria 2061
83 Ga0395900_0064124 3300037418 Bacteria 3776
84 Ga0395900_0120503 3300037418 Bacteria 2692
85 Ga0395905_0130026 3300037471 Bacteria 2368
86 Ga0395905_0200114 3300037471 Bacteria 1873
87 Ga0436364_0511629 3300037853 Bacteria 9953
88 Ga0395901_0135973 3300038443 Bacteria 2583
89 Ga0395901_0195480 3300038443 Bacteria 2121
90 Ga0395901_0306638 3300038443 Bacteria 1645
91 Ga0436365_1797615 3300039437 Bacteria 2160
92 Ga0439450_000323 3300042008 Bacteria 5961
93 Ga0439460_0023136 3300042461 Bacteria 1711
94 Ga0451577_0008381 3300042876 Bacteria 10060
95 Ga0466967_0036152 3300045976 Bacteria 4214
96 Ga0495603_0000539 3300046455 Bacteria 21074
97 Ga0495629_0084562 3300046459 Bacteria 2214
98 Ga0495628_0013384 3300046516 Bacteria 6902
99 Ga0495630_0210016 3300046517 Bacteria 1486
100 Ga0495640_0003906 3300046533 Bacteria 11934
101 Ga0495622_0000582 3300046557 Bacteria 21664
102 Ga0495613_0004694 3300046689 Bacteria 10249
103 Ga0495676_0078780 3300047321 Bacteria 2507
104 Ga0496100_0207205 3300048903 Bacteria 1432
105 Ga0496101_0003981 3300048904 Bacteria 9242
106 Ga0496101_0086739 3300048904 Bacteria 2322
107 Ga0496102_0026376 3300048905 Bacteria 5182
108 Ga0496102_0110679 3300048905 Bacteria 2560
109 Ga0496104_0004166 3300048907 Bacteria 12549
110 Ga0496104_0079152 3300048907 Bacteria 3133
111 Ga0496105_0031025 3300048908 Bacteria 4381
112 Ga0496106_0063818 3300048909 Bacteria 2800
113 Ga0496107_0003332 3300048910 Bacteria 10736
114 Ga0496107_0007932 3300048910 Bacteria 7328
115 Ga0496107_0164629 3300048910 Bacteria 1644
116 Ga0496108_0000551 3300048911 Bacteria 29323
117 Ga0496109_0002377 3300048912 Bacteria 15722
118 Ga0496110_0003533 3300048913 Bacteria 12001
119 Ga0496111_0005626 3300048914 Bacteria 8062
120 Ga0496112_0008286 3300048915 Bacteria 9301
121 Ga0496113_0046941 3300048916 Bacteria 3208
122 Ga0496114_0001966 3300048917 Bacteria 15617
123 Ga0496115_0135310 3300048918 Bacteria 2032
124 Ga0496119_0009103 3300048922 Bacteria 8598
125 Ga0496121_0009582 3300048924 Bacteria 11094
126 Ga0501040_0088385 3300049576 Bacteria 2152
127 Ga0501069_0007133 3300049585 Bacteria 5858
128 Ga0501070_0165833 3300049586 Bacteria 1820
129 Ga0501074_0109078 3300049590 Bacteria 1981
130 Ga0501080_0106329 3300049742 Bacteria 2601
131 nmdc:mga00v17_146996_c1 3300050491 Bacteria 1513
132 nmdc:mga00v17_166094_c1 3300050491 Bacteria 1422
133 nmdc:mga05p37_4558_c1 3300050507 Bacteria 13941
134 nmdc:mga05p37_631185_c1 3300050507 Bacteria 1204
135 nmdc:mga06r32_564890_c1 3300050510 Bacteria 1111
136 nmdc:mga08y16_6225_c1 3300050511 Bacteria 12516
137 Ga0501082_0006488 3300060353 Bacteria 10141
138 Ga0530510_0003976 3300061734 Bacteria 10201
139 2623499634 2622736605 Bacteria 4992138
140 Ga0157376_10036982
141 JGI25406J46586_10004403
142 Ga0070683_100155324
143 Ga0070666_10058926
144 Ga0068868_100035404
145 Ga0070668_100032661
146 Ga0070667_100000714
147 Ga0070713_100087947
148 Ga0070710_10000005
149 Ga0070663_100184110
150 Ga0070706_100020845
151 Ga0070707_100044827
152 Ga0070698_100281403
153 Ga0068853_100014872
154 Ga0070665_100195405
155 Ga0068857_100225127
156 Ga0068856_100299200
157 Ga0070702_100142421
158 Ga0068861_100017633
159 Ga0068860_100055614
160 Ga0068862_100003205
161 Ga0081455_10008505
162 Ga0081455_10087544
163 Ga0081538_10000285
164 Ga0081538_10000731
165 Ga0081538_10002258
166 Ga0081539_10007034
167 Ga0075364_10022410
168 Ga0075428_100007303
169 Ga0075428_100367151
170 Ga0075431_100132276
171 Ga0099794_10150383
172 Ga0111539_10002891
173 Ga0105245_10000095
174 Ga0105245_10347602
175 Ga0114129_10010145
176 Ga0114129_10627546
177 Ga0105243_10026247
178 Ga0105242_10057204
179 Ga0105238_10347242
180 Ga0105249_10001446
181 Ga0163162_10015149
182 Ga0163163_10247372
183 Ga0157379_10010239
184 Ga0213875_10017086
185 Ga0207692_10000003
186 Ga0207687_10000829
187 Ga0207687_10027782
188 Ga0207700_10053872
189 Ga0207644_10186943
190 Ga0207706_10075330
191 Ga0207686_10052641
192 Ga0207686_10190092
193 Ga0207709_10011270
194 Ga0207668_10002606
195 Ga0207658_10008267
196 Ga0207708_10230998
197 Ga0207674_10075958
198 Ga0207675_100023912
199 Ga0207428_10006686
200 Ga0268266_10028495
201 Ga0268265_10013252
202 Ga0265338_10218093
203 Ga0265330_10016040
204 Ga0265329_10015444
205 Ga0316575_10086348
206 Ga0316579_10040319
207 Ga0316576_10006209
208 Ga0316576_10019318
209 Ga0316576_10114596
210 Ga0316578_10026189
211 Ga0307405_10030298
212 Ga0316577_10016020
213 Ga0307407_10189120
214 Ga0307409_100273880
215 Ga0307416_100023872
216 Ga0316585_10006300
217 Ga0316580_10014558
218 Ga0316574_0001443
219 Ga0316574_0073239
220 Ga0316582_0068493
221 Ga0316582_0085998
222 Ga0395900_0064124
223 Ga0395900_0120503
224 Ga0395905_0130026
225 Ga0395905_0200114
226 Ga0436364_0511629
227 Ga0395901_0135973
228 Ga0395901_0195480
229 Ga0395901_0306638
230 Ga0436365_1797615
231 Ga0439450_000323
232 Ga0439460_0023136
233 Ga0451577_0008381
234 Ga0466967_0036152
235 Ga0495603_0000539
236 Ga0495629_0084562
237 Ga0495628_0013384
238 Ga0495630_0210016
239 Ga0495640_0003906
240 Ga0495622_0000582
241 Ga0495613_0004694
242 Ga0495676_0078780
243 Ga0496100_0207205
244 Ga0496101_0003981
245 Ga0496101_0086739
246 Ga0496102_0026376
247 Ga0496102_0110679
248 Ga0496104_0004166
249 Ga0496104_0079152
250 Ga0496105_0031025
251 Ga0496106_0063818
252 Ga0496107_0003332
253 Ga0496107_0007932
254 Ga0496107_0164629
255 Ga0496108_0000551
256 Ga0496109_0002377
257 Ga0496110_0003533
258 Ga0496111_0005626
259 Ga0496112_0008286
260 Ga0496113_0046941
261 Ga0496114_0001966
262 Ga0496115_0135310
263 Ga0496119_0009103
264 Ga0496121_0009582
265 Ga0501040_0088385
266 Ga0501069_0007133
267 Ga0501070_0165833
268 Ga0501074_0109078
269 Ga0501080_0106329
270 nmdc:mga00v17_146996_c1
271 nmdc:mga00v17_166094_c1
272 nmdc:mga05p37_4558_c1
273 nmdc:mga05p37_631185_c1
274 nmdc:mga06r32_564890_c1
275 nmdc:mga08y16_6225_c1
276 Ga0501082_0006488
277 Ga0530510_0003976
278 2623499634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

182

311

0.89

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

24

142

0.87

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

215

344

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h2b-assembly1.cif.gz_B crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution 0.9752 1 341
2eer-assembly1.cif.gz_B structural study of project id st2577 from sulfolobus tokodaii strain7 0.9355 1 341
6n7l-assembly3.cif.gz_K crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1 0.9321 1 340
2xaa-assembly3.cif.gz_B alcohol dehydrogenase adh-'a' from rhodococcus ruber dsm 44541 at ph 8.5 in complex with nad and butane-1,4-diol 0.9289 1 341
5od3-assembly1.cif.gz_A crystal structure of r. ruber adh-a, mutant y54g, l119y 0.9284 1 342
ID Description Score Start End Superfamily
1h2bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9786 152 290 3.40.50.720
1h2bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.965 152 290 3.40.50.720
1ntoA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9348 156 290 3.40.50.720
af_Q17334_7_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9343 2 149 3.90.180.10
af_A0A1D8PNH7_186_307_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9257 170 286 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A177ET13-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9838 1 340 GO:0008270
GO:0016491
GO:0043231
AF-A0A350JDE9-F1-model_v4 deleted 0.9768 186 341
AF-A0A848DDF5-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9726 1 341 GO:0008270
GO:0016491
AF-A0A528BZ19-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.97 128 341
AF-A0A848DDF5-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9698 1 341 GO:0008270
GO:0016491

Map