F175926

General Info

Members Datasets Scaffolds Average Seq Length
139 116 278 117

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10538988|Ga0075369_105389881
Length 135
Sequence MSTDALSTTFAALADPTRRAILARLASGDCSVTELATPFEMSLPAVSKHLRVLERAGLVVRGREAQWRPCRLEAAPLKDVADWAATYRHLWEARLDRLDSYLQQLQGRTPAAARKAPIPSHKETRPHARHPRRRH

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
66 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
67 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
77 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
83 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
109 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
114 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
115 2643221580 Devosia sp. Root635 Isolate Unclassified
116 2643221723 Ensifer sp. Root278 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 0
Rhizoplane 5.04
Rhizosphere 84.17
Stem 0
Stem Tuber 0
Unclassified 11.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10538988 3300006186 Bacteria 556
2 Ga0070682_101130666 3300005337 Bacteria 657
3 Ga0070661_100747817 3300005344 Bacteria 799
4 Ga0070675_100141697 3300005354 Unclassified 2055
5 Ga0070713_100486316 3300005436 Bacteria 1163
6 Ga0070711_100501331 3300005439 Unclassified 1001
7 Ga0070711_101815217 3300005439 Bacteria 535
8 Ga0070694_100731285 3300005444 Bacteria 807
9 Ga0070708_100552190 3300005445 Unclassified 1086
10 Ga0070681_10189630 3300005458 Bacteria 1975
11 Ga0070681_10716910 3300005458 Bacteria 916
12 Ga0070706_100142670 3300005467 Bacteria 2236
13 Ga0070706_100158281 3300005467 Bacteria 2114
14 Ga0070706_100851361 3300005467 Unclassified 843
15 Ga0070698_100244278 3300005471 Bacteria 1728
16 Ga0070699_100010459 3300005518 Bacteria 8029
17 Ga0070699_100122662 3300005518 Bacteria 2286
18 Ga0070665_100197986 3300005548 Bacteria 2010
19 Ga0070665_100221190 3300005548 Bacteria 1894
20 Ga0070704_101042556 3300005549 Bacteria 741
21 Ga0068857_102078887 3300005577 Bacteria 557
22 Ga0068856_100860504 3300005614 Bacteria 926
23 Ga0068860_100201815 3300005843 Bacteria 1927
24 Ga0075363_100550117 3300006048 Bacteria 688
25 Ga0068871_102408242 3300006358 Unclassified 502
26 Ga0075428_100439859 3300006844 Bacteria 1397
27 Ga0075431_101130776 3300006847 Bacteria 747
28 Ga0075433_10013202 3300006852 Bacteria 6705
29 Ga0075433_10262822 3300006852 Bacteria 1530
30 Ga0075434_101391636 3300006871 Unclassified 712
31 Ga0075435_100609931 3300007076 Unclassified 947
32 Ga0114129_10003001 3300009147 Bacteria 23642
33 Ga0114129_10462863 3300009147 Unclassified 1662
34 Ga0105241_10000062 3300009174 Bacteria 81327
35 Ga0105248_11054617 3300009177 Unclassified 918
36 Ga0105239_10629818 3300010375 Bacteria 1224
37 Ga0105239_11876572 3300010375 Bacteria 695
38 Ga0157380_10272672 3300014326 Bacteria 1543
39 Ga0157376_10407279 3300014969 Unclassified 1316
40 Ga0157376_10434592 3300014969 Bacteria 1277
41 Ga0213875_10547619 3300021388 Bacteria 557
42 Ga0207684_10186951 3300025910 Bacteria 1786
43 Ga0207684_10364910 3300025910 Bacteria 1243
44 Ga0207684_11383816 3300025910 Bacteria 576
45 Ga0207654_10000077 3300025911 Bacteria 64031
46 Ga0207707_10575593 3300025912 Bacteria 955
47 Ga0207695_10287908 3300025913 Bacteria 1535
48 Ga0207663_11090158 3300025916 Unclassified 642
49 Ga0207646_10075961 3300025922 Bacteria 3002
50 Ga0207650_11863891 3300025925 Bacteria 508
51 Ga0207659_10194661 3300025926 Unclassified 1615
52 Ga0207690_10667889 3300025932 Bacteria 853
53 Ga0207670_10362379 3300025936 Bacteria 1150
54 Ga0207669_10634978 3300025937 Bacteria 872
55 Ga0207665_10294136 3300025939 Bacteria 1212
56 Ga0207711_10000014 3300025941 Bacteria 506753
57 Ga0207711_10000016 3300025941 Bacteria 486741
58 Ga0207702_11024386 3300026078 Bacteria 819
59 Ga0209983_1134035 3300027665 Bacteria 566
60 Ga0268266_10058754 3300028379 Bacteria 3312
61 Ga0268266_10185156 3300028379 Bacteria 1898
62 Ga0268266_10810668 3300028379 Bacteria 904
63 Ga0268266_11844432 3300028379 Bacteria 579
64 Ga0268264_12439909 3300028381 Bacteria 529
65 Ga0265319_1200742 3300028563 Unclassified 612
66 Ga0307512_10405991 3300030522 Bacteria 570
67 Ga0265320_10000961 3300031240 Bacteria 21418
68 Ga0307509_10303504 3300031507 Bacteria 1343
69 Ga0307413_10157061 3300031824 Bacteria 1593
70 Ga0307518_10000486 3300031838 Bacteria 30309
71 Ga0307406_11375978 3300031901 Bacteria 618
72 Ga0307407_11005881 3300031903 Unclassified 644
73 Ga0307412_10122611 3300031911 Bacteria 1874
74 Ga0307409_101852937 3300031995 Bacteria 632
75 Ga0307416_100625807 3300032002 Bacteria 1159
76 Ga0307416_102788340 3300032002 Bacteria 584
77 Ga0307414_10352683 3300032004 Bacteria 1263
78 Ga0307414_10409137 3300032004 Bacteria 1180
79 Ga0307414_11583929 3300032004 Bacteria 610
80 Ga0307411_11412968 3300032005 Bacteria 637
81 Ga0395898_0176252 3300037466 Bacteria 2043
82 Ga0436364_1348251 3300037853 Bacteria 736
83 Ga0395901_0005744 3300038443 Bacteria 12566
84 Ga0450923_041607 3300042125 Bacteria 967
85 Ga0450906_109547 3300042145 Bacteria 506
86 Ga0450908_087971 3300042184 Bacteria 561
87 Ga0466966_0587494 3300044684 Bacteria 670
88 Ga0495603_0026211 3300046455 Bacteria 3522
89 Ga0495629_0100138 3300046459 Bacteria 2022
90 Ga0495651_0088292 3300046462 Bacteria 2330
91 Ga0495582_0516012 3300046473 Bacteria 691
92 Ga0495664_0109763 3300046477 Bacteria 1665
93 Ga0495594_0365761 3300046499 Bacteria 821
94 Ga0495608_0273963 3300046511 Bacteria 1049
95 Ga0495640_0628125 3300046533 Bacteria 647
96 Ga0495667_0225294 3300046559 Bacteria 1196
97 Ga0495634_0279785 3300046642 Bacteria 1014
98 Ga0495635_0224085 3300046663 Bacteria 1271
99 Ga0495657_0559400 3300046675 Bacteria 664
100 Ga0495599_0383335 3300046678 Bacteria 839
101 Ga0495623_0227492 3300046679 Bacteria 1060
102 Ga0495646_0247479 3300046680 Bacteria 956
103 Ga0495613_0012913 3300046689 Bacteria 6207
104 Ga0495604_0150113 3300047317 Bacteria 1657
105 Ga0495636_0334784 3300047318 Bacteria 712
106 Ga0495676_0012874 3300047321 Bacteria 7523
107 Ga0495675_0475093 3300047444 Bacteria 721
108 Ga0495593_0051643 3300047673 Bacteria 2175
109 Ga0495614_0056988 3300048089 Bacteria 1677
110 Ga0496104_0903428 3300048907 Bacteria 788
111 Ga0496104_1381251 3300048907 Bacteria 607
112 Ga0496104_1628824 3300048907 Unclassified 548
113 Ga0496107_0006272 3300048910 Bacteria 8174
114 Ga0496114_0290735 3300048917 Bacteria 1442
115 Ga0496115_0003382 3300048918 Bacteria 11447
116 Ga0496126_0013275 3300048929 Bacteria 8394
117 Ga0496126_0197226 3300048929 Bacteria 1702
118 Ga0496126_0885675 3300048929 Bacteria 678
119 Ga0501034_0000440 3300049571 Bacteria 68848
120 Ga0501036_0724278 3300049572 Bacteria 821
121 Ga0501039_1393915 3300049575 Bacteria 540
122 Ga0501072_0170482 3300049588 Bacteria 1737
123 Ga0501076_0085078 3300049592 Bacteria 2541
124 Ga0501077_0501324 3300049593 Bacteria 778
125 Ga0501249_035876 3300049679 Unclassified 1116
126 Ga0501080_0649462 3300049742 Bacteria 934
127 nmdc:mga05p37_2333_c1 3300050507 Bacteria 22090
128 nmdc:mga06r32_1117049_c1 3300050510 Bacteria 737
129 nmdc:mga0rr50_213692_c1 3300050513 Bacteria 1590
130 nmdc:mga0a205_29287_c1 3300050515 Bacteria 5268
131 Ga0495612_0122109 3300053078 Bacteria 1121
132 Ga0500644_0026812 3300053088 Bacteria 1786
133 Ga0500595_009007 3300053119 Bacteria 4053
134 Ga0500604_0000162 3300053151 Bacteria 19306
135 Ga0501084_0567046 3300054114 Bacteria 959
136 2585297428 2582581312 Bacteria 7308206
137 2600194157 2599185352 Bacteria 7228948
138 2643909541 2643221580 Bacteria 3816678
139 2644676675 2643221723 Bacteria 7095460
140 Ga0075369_10538988
141 Ga0070682_101130666
142 Ga0070661_100747817
143 Ga0070675_100141697
144 Ga0070713_100486316
145 Ga0070711_100501331
146 Ga0070711_101815217
147 Ga0070694_100731285
148 Ga0070708_100552190
149 Ga0070681_10189630
150 Ga0070681_10716910
151 Ga0070706_100142670
152 Ga0070706_100158281
153 Ga0070706_100851361
154 Ga0070698_100244278
155 Ga0070699_100010459
156 Ga0070699_100122662
157 Ga0070665_100197986
158 Ga0070665_100221190
159 Ga0070704_101042556
160 Ga0068857_102078887
161 Ga0068856_100860504
162 Ga0068860_100201815
163 Ga0075363_100550117
164 Ga0068871_102408242
165 Ga0075428_100439859
166 Ga0075431_101130776
167 Ga0075433_10013202
168 Ga0075433_10262822
169 Ga0075434_101391636
170 Ga0075435_100609931
171 Ga0114129_10003001
172 Ga0114129_10462863
173 Ga0105241_10000062
174 Ga0105248_11054617
175 Ga0105239_10629818
176 Ga0105239_11876572
177 Ga0157380_10272672
178 Ga0157376_10407279
179 Ga0157376_10434592
180 Ga0213875_10547619
181 Ga0207684_10186951
182 Ga0207684_10364910
183 Ga0207684_11383816
184 Ga0207654_10000077
185 Ga0207707_10575593
186 Ga0207695_10287908
187 Ga0207663_11090158
188 Ga0207646_10075961
189 Ga0207650_11863891
190 Ga0207659_10194661
191 Ga0207690_10667889
192 Ga0207670_10362379
193 Ga0207669_10634978
194 Ga0207665_10294136
195 Ga0207711_10000014
196 Ga0207711_10000016
197 Ga0207702_11024386
198 Ga0209983_1134035
199 Ga0268266_10058754
200 Ga0268266_10185156
201 Ga0268266_10810668
202 Ga0268266_11844432
203 Ga0268264_12439909
204 Ga0265319_1200742
205 Ga0307512_10405991
206 Ga0265320_10000961
207 Ga0307509_10303504
208 Ga0307413_10157061
209 Ga0307518_10000486
210 Ga0307406_11375978
211 Ga0307407_11005881
212 Ga0307412_10122611
213 Ga0307409_101852937
214 Ga0307416_100625807
215 Ga0307416_102788340
216 Ga0307414_10352683
217 Ga0307414_10409137
218 Ga0307414_11583929
219 Ga0307411_11412968
220 Ga0395898_0176252
221 Ga0436364_1348251
222 Ga0395901_0005744
223 Ga0450923_041607
224 Ga0450906_109547
225 Ga0450908_087971
226 Ga0466966_0587494
227 Ga0495603_0026211
228 Ga0495629_0100138
229 Ga0495651_0088292
230 Ga0495582_0516012
231 Ga0495664_0109763
232 Ga0495594_0365761
233 Ga0495608_0273963
234 Ga0495640_0628125
235 Ga0495667_0225294
236 Ga0495634_0279785
237 Ga0495635_0224085
238 Ga0495657_0559400
239 Ga0495599_0383335
240 Ga0495623_0227492
241 Ga0495646_0247479
242 Ga0495613_0012913
243 Ga0495604_0150113
244 Ga0495636_0334784
245 Ga0495676_0012874
246 Ga0495675_0475093
247 Ga0495593_0051643
248 Ga0495614_0056988
249 Ga0496104_0903428
250 Ga0496104_1381251
251 Ga0496104_1628824
252 Ga0496107_0006272
253 Ga0496114_0290735
254 Ga0496115_0003382
255 Ga0496126_0013275
256 Ga0496126_0197226
257 Ga0496126_0885675
258 Ga0501034_0000440
259 Ga0501036_0724278
260 Ga0501039_1393915
261 Ga0501072_0170482
262 Ga0501076_0085078
263 Ga0501077_0501324
264 Ga0501249_035876
265 Ga0501080_0649462
266 nmdc:mga05p37_2333_c1
267 nmdc:mga06r32_1117049_c1
268 nmdc:mga0rr50_213692_c1
269 nmdc:mga0a205_29287_c1
270 Ga0495612_0122109
271 Ga0500644_0026812
272 Ga0500595_009007
273 Ga0500604_0000162
274 Ga0501084_0567046
275 2585297428
276 2600194157
277 2643909541
278 2644676675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

60

0.99

PF12840

HTH_20

Helix-turn-helix domain

13

62

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

15

60

0.97

PF12802

MarR_2

MarR family

15

66

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.948 1 87
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9385 1 89
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9367 4 92
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9037 18 73
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9021 3 81
ID Description Score Start End Superfamily
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9334 17 72 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9232 1 85 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 3 82 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9147 3 84 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9141 17 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2M8HG34-F1-model_v4 Transcriptional regulator 0.9922 1 89 GO:0003700
AF-A0A1H7BVU5-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9911 2 89 GO:0003677
GO:0003700
AF-A0A7W0YP81-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.988 2 89 GO:0003700
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9797 3 85 GO:0003700
AF-A0A1Y5SRI5-F1-model_v4 Transcriptional repressor SdpR 0.974 4 110 GO:0003700

Map