F175151

General Info

Members Datasets Scaffolds Average Seq Length
139 61 139 229

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10006223|Ga0065707_100062232
Length 238
Sequence VLLDQWDNFMKIIKNEKLIKRNATIGNWTSIAALVILGGGMYISFKRTELFAYSLIALLVGFTLTQIGMYMGNKFGRSPRPDEKLDAGLKGLQNDFVMYHYTTPASHLLVGPGGVWVVMPYHQRGQVMFKKNRWRMSGGGFLQSYMRIFGQEGLGRPDIEIDGEITSLKKYLSKKMDASEIPEIHALMVFTNDDVEIDGEDSPVPAMKLKQVKEFLRQKAKEKKLPAETLNELKTALE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
44 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
45 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
46 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
47 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
50 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
51 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
52 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
53 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
54 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
55 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
56 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
57 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
58 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
59 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
60 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
61 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_895287 2162886007 Unclassified 2953
2 Ga0065704_10000314 3300005289 Bacteria 38202
3 Ga0065707_10006223 3300005295 Bacteria 3660
4 Ga0065707_10098499 3300005295 Bacteria 3081
5 Ga0065707_10112410 3300005295 Bacteria 2360
6 Ga0065707_10190088 3300005295 Bacteria 1366
7 Ga0065707_10250984 3300005295 Bacteria 1125
8 Ga0070680_100086531 3300005336 Bacteria 2591
9 Ga0070688_100193253 3300005365 Unclassified 1419
10 Ga0070700_100076864 3300005441 Bacteria 2145
11 Ga0070700_100358091 3300005441 Unclassified 1084
12 Ga0070708_100536164 3300005445 Bacteria 1104
13 Ga0070698_100028426 3300005471 Bacteria 5807
14 Ga0070698_100204371 3300005471 Bacteria 1910
15 Ga0070698_100503127 3300005471 Bacteria 1149
16 Ga0070699_100000415 3300005518 Bacteria 40941
17 Ga0070699_100081324 3300005518 Bacteria 2824
18 Ga0070695_100750626 3300005545 Unclassified 778
19 Ga0070704_100307147 3300005549 Bacteria 1324
20 Ga0068857_100088288 3300005577 Unclassified 2774
21 Ga0068859_100070847 3300005617 Unclassified 3522
22 Ga0068859_100660430 3300005617 Bacteria 1137
23 Ga0068862_100078386 3300005844 Bacteria 2862
24 Ga0068862_100796272 3300005844 Bacteria 923
25 Ga0081539_10001669 3300005985 Bacteria 35918
26 Ga0081539_10012415 3300005985 Bacteria 6567
27 Ga0075428_100010318 3300006844 Bacteria 10367
28 Ga0075428_100159279 3300006844 Bacteria 2450
29 Ga0075428_100795053 3300006844 Unclassified 1006
30 Ga0075431_100029547 3300006847 Bacteria 5643
31 Ga0075431_100204840 3300006847 Unclassified 2017
32 Ga0075431_100363226 3300006847 Bacteria 1454
33 Ga0075429_100011207 3300006880 Bacteria 7763
34 Ga0075429_100022549 3300006880 Bacteria 5459
35 Ga0075429_100023766 3300006880 Bacteria 5318
36 Ga0075429_100123795 3300006880 Bacteria 2261
37 Ga0097620_100070848 3300006931 Unclassified 3522
38 Ga0097620_100660401 3300006931 Bacteria 1137
39 Ga0111539_10106199 3300009094 Bacteria 3294
40 Ga0114129_10003328 3300009147 Bacteria 22584
41 Ga0114129_10029967 3300009147 Bacteria 7705
42 Ga0114129_10134349 3300009147 Bacteria 3395
43 Ga0114129_10193135 3300009147 Bacteria 2763
44 Ga0114129_10304314 3300009147 Bacteria 2124
45 Ga0114129_10391485 3300009147 Unclassified 1833
46 Ga0114129_10934768 3300009147 Bacteria 1096
47 Ga0105249_10533557 3300009553 Bacteria 1222
48 Ga0105246_10026646 3300011119 Bacteria 3780
49 Ga0157380_10087311 3300014326 Bacteria 2564
50 Ga0207660_10601882 3300025917 Unclassified 895
51 Ga0207646_10205811 3300025922 Unclassified 1777
52 Ga0207712_10084699 3300025961 Unclassified 2317
53 Ga0207712_10207871 3300025961 Unclassified 1557
54 Ga0207708_10590293 3300026075 Unclassified 940
55 Ga0207676_10340234 3300026095 Unclassified 1384
56 Ga0207674_10213834 3300026116 Unclassified 1877
57 Ga0207675_100188624 3300026118 Bacteria 1977
58 Ga0316575_10007438 3300031665 Bacteria 3966
59 Ga0316576_10300309 3300031727 Bacteria 1200
60 Ga0316578_10050820 3300031728 Bacteria 2426
61 Ga0316578_10073383 3300031728 Bacteria 2028
62 Ga0307405_10145540 3300031731 Bacteria 1659
63 Ga0307405_10185425 3300031731 Unclassified 1498
64 Ga0316577_10013006 3300031733 Bacteria 4540
65 Ga0307410_10263112 3300031852 Bacteria 1346
66 Ga0307406_10100298 3300031901 Bacteria 1971
67 Ga0307416_100056994 3300032002 Bacteria 3158
68 Ga0307416_100188511 3300032002 Bacteria 1942
69 Ga0316574_0268368 3300035398 Bacteria 1088
70 Ga0316582_0001183 3300036647 Bacteria 11185
71 Ga0316582_0060176 3300036647 Unclassified 2434
72 Ga0316584_0057711 3300036712 Unclassified 2906
73 Ga0316584_0071490 3300036712 Bacteria 2599
74 Ga0316584_0427478 3300036712 Unclassified 940
75 Ga0451577_0025167 3300042876 Bacteria 5402
76 Ga0451577_0207525 3300042876 Unclassified 1769
77 Ga0451577_0513465 3300042876 Bacteria 1088
78 Ga0451577_0515996 3300042876 Unclassified 1085
79 Ga0453683_0000232 3300044673 Bacteria 74369
80 Ga0453683_0002823 3300044673 Bacteria 13194
81 Ga0453683_0033015 3300044673 Unclassified 3264
82 Ga0453683_0037632 3300044673 Bacteria 3043
83 Ga0453683_0059157 3300044673 Bacteria 2396
84 Ga0453683_0323628 3300044673 Unclassified 988
85 Ga0453683_0500702 3300044673 Bacteria 788
86 Ga0453684_0000415 3300044712 Bacteria 174067
87 Ga0453684_0002646 3300044712 Bacteria 42771
88 Ga0453684_0006192 3300044712 Bacteria 22948
89 Ga0453684_0015710 3300044712 Bacteria 11926
90 Ga0453684_0016595 3300044712 Bacteria 11493
91 Ga0453684_0022418 3300044712 Bacteria 9367
92 Ga0453684_0048904 3300044712 Bacteria 5584
93 Ga0453684_0103847 3300044712 Bacteria 3471
94 Ga0453684_0116284 3300044712 Bacteria 3239
95 Ga0453684_0162243 3300044712 Bacteria 2642
96 Ga0453684_0182535 3300044712 Bacteria 2462
97 Ga0453684_0252081 3300044712 Bacteria 2026
98 Ga0453684_0259262 3300044712 Bacteria 1992
99 Ga0453684_0327997 3300044712 Bacteria 1731
100 Ga0453684_0369613 3300044712 Bacteria 1612
101 Ga0453684_0403121 3300044712 Unclassified 1531
102 Ga0453684_0466974 3300044712 Unclassified 1402
103 Ga0453684_0551555 3300044712 Bacteria 1269
104 Ga0453684_0729405 3300044712 Bacteria 1074
105 Ga0453684_0737396 3300044712 Bacteria 1067
106 Ga0453684_1016668 3300044712 Unclassified 880
107 Ga0453684_1042092 3300044712 Unclassified 868
108 Ga0453684_1402113 3300044712 Unclassified 725
109 Ga0451576_0001855 3300045051 Bacteria 34202
110 Ga0451576_0086478 3300045051 Bacteria 3261
111 Ga0451576_0349427 3300045051 Bacteria 1548
112 Ga0451576_0629678 3300045051 Unclassified 1127
113 Ga0451576_0869396 3300045051 Bacteria 946
114 Ga0451576_0869938 3300045051 Unclassified 946
115 Ga0501040_0047711 3300049576 Bacteria 2925
116 Ga0501046_0166355 3300049580 Bacteria 1657
117 Ga0501068_0291285 3300049584 Unclassified 1044
118 Ga0501072_0037225 3300049588 Bacteria 3816
119 Ga0501072_0404524 3300049588 Bacteria 1083
120 Ga0501074_0060754 3300049590 Bacteria 2723
121 Ga0501075_0011589 3300049591 Bacteria 6243
122 Ga0501075_0087534 3300049591 Unclassified 2361
123 Ga0501076_0007126 3300049592 Bacteria 8127
124 Ga0501079_0479704 3300049741 Bacteria 977
125 Ga0501080_0101064 3300049742 Bacteria 2675
126 Ga0501081_0036976 3300049743 Bacteria 3331
127 nmdc:mga05p37_21471_c1 3300050507 Bacteria 7820
128 nmdc:mga05p37_25420_c1 3300050507 Bacteria 7201
129 nmdc:mga05p37_286228_c1 3300050507 Bacteria 1963
130 nmdc:mga05p37_5260_c1 3300050507 Bacteria 15190
131 nmdc:mga05p37_55253_c1 3300050507 Bacteria 4885
132 nmdc:mga05p37_747564_c1 3300050507 Unclassified 1078
133 nmdc:mga09592_168040_c1 3300050508 Bacteria 1896
134 nmdc:mga09592_218724_c1 3300050508 Bacteria 1651
135 nmdc:mga09592_27725_c1 3300050508 Bacteria 4701
136 nmdc:mga0qj67_111932_c1 3300050509 Bacteria 2204
137 nmdc:mga0n895_1185736_c1 3300050512 Bacteria 738
138 Ga0501082_0041337 3300060353 Bacteria 3975
139 Ga0501082_0550827 3300060353 Bacteria 1009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031728 Ga0316578_10073383 Ga0316578_100733831 188
2 3300036647 Ga0316582_0060176 Ga0316582_0060176_716_1411 188
3 3300035398 Ga0316574_0268368 Ga0316574_0268368_56_655 195
4 3300036712 Ga0316584_0071490 Ga0316584_0071490_1944_2543 195
5 3300044712 Ga0453684_1402113 Ga0453684_1402113_45_647 198
6 3300045051 Ga0451576_0869396 Ga0451576_0869396_324_920 198
7 3300026116 Ga0207674_10213834 Ga0207674_102138341 210
8 3300044673 Ga0453683_0500702 Ga0453683_0500702_91_750 215
9 3300044712 Ga0453684_0116284 Ga0453684_0116284_624_1349 215
10 3300031665 Ga0316575_10007438 Ga0316575_100074383 226
11 3300031727 Ga0316576_10300309 Ga0316576_103003092 226
12 3300031728 Ga0316578_10050820 Ga0316578_100508201 226
13 3300031733 Ga0316577_10013006 Ga0316577_100130066 226
14 3300036647 Ga0316582_0001183 Ga0316582_0001183_9949_10641 226
15 3300005289 Ga0065704_10000314 Ga0065704_100003142 229
16 3300005295 Ga0065707_10098499 Ga0065707_100984993 229
17 3300005295 Ga0065707_10112410 Ga0065707_101124103 229
18 3300005295 Ga0065707_10190088 Ga0065707_101900881 229
19 3300005295 Ga0065707_10250984 Ga0065707_102509842 229
20 3300005336 Ga0070680_100086531 Ga0070680_1000865312 229
21 3300005365 Ga0070688_100193253 Ga0070688_1001932532 229
22 3300005441 Ga0070700_100076864 Ga0070700_1000768642 229
23 3300005441 Ga0070700_100358091 Ga0070700_1003580911 229
24 3300005445 Ga0070708_100536164 Ga0070708_1005361642 229
25 3300005471 Ga0070698_100028426 Ga0070698_1000284265 229
26 3300005471 Ga0070698_100204371 Ga0070698_1002043712 229
27 3300005471 Ga0070698_100503127 Ga0070698_1005031272 229
28 3300005518 Ga0070699_100000415 Ga0070699_10000041537 229
29 3300005518 Ga0070699_100081324 Ga0070699_1000813242 229
30 3300005545 Ga0070695_100750626 Ga0070695_1007506261 229
31 3300005549 Ga0070704_100307147 Ga0070704_1003071472 229
32 3300005577 Ga0068857_100088288 Ga0068857_1000882882 229
33 3300005617 Ga0068859_100070847 Ga0068859_1000708472 229
34 3300005617 Ga0068859_100660430 Ga0068859_1006604301 229
35 3300005844 Ga0068862_100078386 Ga0068862_1000783862 229
36 3300005844 Ga0068862_100796272 Ga0068862_1007962721 229
37 3300005985 Ga0081539_10001669 Ga0081539_1000166917 229
38 3300005985 Ga0081539_10012415 Ga0081539_100124155 229
39 3300006844 Ga0075428_100010318 Ga0075428_1000103186 229
40 3300006844 Ga0075428_100159279 Ga0075428_1001592792 229
41 3300006844 Ga0075428_100795053 Ga0075428_1007950532 229
42 3300006847 Ga0075431_100029547 Ga0075431_1000295473 229
43 3300006847 Ga0075431_100204840 Ga0075431_1002048402 229
44 3300006847 Ga0075431_100363226 Ga0075431_1003632261 229
45 3300006880 Ga0075429_100011207 Ga0075429_1000112073 229
46 3300006880 Ga0075429_100022549 Ga0075429_1000225493 229
47 3300006880 Ga0075429_100023766 Ga0075429_1000237663 229
48 3300006880 Ga0075429_100123795 Ga0075429_1001237952 229
49 3300006931 Ga0097620_100070848 Ga0097620_1000708482 229
50 3300006931 Ga0097620_100660401 Ga0097620_1006604012 229
51 3300009094 Ga0111539_10106199 Ga0111539_101061992 229
52 3300009147 Ga0114129_10003328 Ga0114129_100033283 229
53 3300009147 Ga0114129_10029967 Ga0114129_100299675 229
54 3300009147 Ga0114129_10134349 Ga0114129_101343493 229
55 3300009147 Ga0114129_10193135 Ga0114129_101931351 229
56 3300009147 Ga0114129_10304314 Ga0114129_103043142 229
57 3300009147 Ga0114129_10391485 Ga0114129_103914852 229
58 3300009147 Ga0114129_10934768 Ga0114129_109347681 229
59 3300009553 Ga0105249_10533557 Ga0105249_105335572 229
60 3300011119 Ga0105246_10026646 Ga0105246_100266462 229
61 3300014326 Ga0157380_10087311 Ga0157380_100873112 229
62 3300025917 Ga0207660_10601882 Ga0207660_106018821 229
63 3300025961 Ga0207712_10084699 Ga0207712_100846992 229
64 3300025961 Ga0207712_10207871 Ga0207712_102078712 229
65 3300026075 Ga0207708_10590293 Ga0207708_105902932 229
66 3300026095 Ga0207676_10340234 Ga0207676_103402342 229
67 3300026118 Ga0207675_100188624 Ga0207675_1001886242 229
68 3300031731 Ga0307405_10145540 Ga0307405_101455402 229
69 3300031731 Ga0307405_10185425 Ga0307405_101854252 229
70 3300031852 Ga0307410_10263112 Ga0307410_102631122 229
71 3300031901 Ga0307406_10100298 Ga0307406_101002982 229
72 3300032002 Ga0307416_100056994 Ga0307416_1000569945 229
73 3300032002 Ga0307416_100188511 Ga0307416_1001885111 229
74 3300036712 Ga0316584_0057711 Ga0316584_0057711_1596_2288 229
75 3300036712 Ga0316584_0427478 Ga0316584_0427478_144_836 229
76 3300042876 Ga0451577_0025167 Ga0451577_0025167_1261_1953 229
77 3300042876 Ga0451577_0207525 Ga0451577_0207525_256_948 229
78 3300042876 Ga0451577_0513465 Ga0451577_0513465_220_912 229
79 3300042876 Ga0451577_0515996 Ga0451577_0515996_355_1050 229
80 3300044673 Ga0453683_0000232 Ga0453683_0000232_69491_70186 229
81 3300044673 Ga0453683_0002823 Ga0453683_0002823_10554_11249 229
82 3300044673 Ga0453683_0033015 Ga0453683_0033015_155_847 229
83 3300044673 Ga0453683_0037632 Ga0453683_0037632_340_1035 229
84 3300044673 Ga0453683_0059157 Ga0453683_0059157_492_1181 229
85 3300044673 Ga0453683_0323628 Ga0453683_0323628_13_702 229
86 3300044712 Ga0453684_0000415 Ga0453684_0000415_25078_25773 229
87 3300044712 Ga0453684_0002646 Ga0453684_0002646_23381_24073 229
88 3300044712 Ga0453684_0006192 Ga0453684_0006192_10592_11305 229
89 3300044712 Ga0453684_0015710 Ga0453684_0015710_1089_1781 229
90 3300044712 Ga0453684_0016595 Ga0453684_0016595_313_1005 229
91 3300044712 Ga0453684_0022418 Ga0453684_0022418_7713_8408 229
92 3300044712 Ga0453684_0048904 Ga0453684_0048904_3829_4530 229
93 3300044712 Ga0453684_0103847 Ga0453684_0103847_2323_3018 229
94 3300044712 Ga0453684_0162243 Ga0453684_0162243_1844_2539 229
95 3300044712 Ga0453684_0182535 Ga0453684_0182535_604_1299 229
96 3300044712 Ga0453684_0252081 Ga0453684_0252081_1019_1714 229
97 3300044712 Ga0453684_0259262 Ga0453684_0259262_526_1227 229
98 3300044712 Ga0453684_0327997 Ga0453684_0327997_742_1434 229
99 3300044712 Ga0453684_0369613 Ga0453684_0369613_306_998 229
100 3300044712 Ga0453684_0403121 Ga0453684_0403121_520_1221 229
101 3300044712 Ga0453684_0466974 Ga0453684_0466974_537_1232 229
102 3300044712 Ga0453684_0551555 Ga0453684_0551555_96_797 229
103 3300044712 Ga0453684_0729405 Ga0453684_0729405_84_776 229
104 3300044712 Ga0453684_0737396 Ga0453684_0737396_33_725 229
105 3300044712 Ga0453684_1016668 Ga0453684_1016668_138_842 229
106 3300044712 Ga0453684_1042092 Ga0453684_1042092_92_781 229
107 3300045051 Ga0451576_0001855 Ga0451576_0001855_28688_29383 229
108 3300045051 Ga0451576_0086478 Ga0451576_0086478_1919_2620 229
109 3300045051 Ga0451576_0349427 Ga0451576_0349427_182_877 229
110 3300045051 Ga0451576_0629678 Ga0451576_0629678_216_905 229
111 3300045051 Ga0451576_0869938 Ga0451576_0869938_15_704 229
112 3300049576 Ga0501040_0047711 Ga0501040_0047711_216_908 229
113 3300049580 Ga0501046_0166355 Ga0501046_0166355_305_997 229
114 3300049584 Ga0501068_0291285 Ga0501068_0291285_88_780 229
115 3300049588 Ga0501072_0037225 Ga0501072_0037225_1176_1868 229
116 3300049588 Ga0501072_0404524 Ga0501072_0404524_38_733 229
117 3300049590 Ga0501074_0060754 Ga0501074_0060754_778_1470 229
118 3300049591 Ga0501075_0011589 Ga0501075_0011589_696_1388 229
119 3300049591 Ga0501075_0087534 Ga0501075_0087534_631_1326 229
120 3300049592 Ga0501076_0007126 Ga0501076_0007126_5477_6169 229
121 3300049741 Ga0501079_0479704 Ga0501079_0479704_169_864 229
122 3300049742 Ga0501080_0101064 Ga0501080_0101064_429_1121 229
123 3300049743 Ga0501081_0036976 Ga0501081_0036976_1465_2157 229
124 3300050507 nmdc:mga05p37_21471_c1 nmdc:mga05p37_21471_c1_212_901 229
125 3300050507 nmdc:mga05p37_25420_c1 nmdc:mga05p37_25420_c1_1998_2699 229
126 3300050507 nmdc:mga05p37_286228_c1 nmdc:mga05p37_286228_c1_182_871 229
127 3300050507 nmdc:mga05p37_5260_c1 nmdc:mga05p37_5260_c1_336_1025 229
128 3300050507 nmdc:mga05p37_55253_c1 nmdc:mga05p37_55253_c1_738_1439 229
129 3300050507 nmdc:mga05p37_747564_c1 nmdc:mga05p37_747564_c1_20_709 229
130 3300050508 nmdc:mga09592_168040_c1 nmdc:mga09592_168040_c1_266_967 229
131 3300050508 nmdc:mga09592_218724_c1 nmdc:mga09592_218724_c1_224_913 229
132 3300050508 nmdc:mga09592_27725_c1 nmdc:mga09592_27725_c1_680_1381 229
133 3300050509 nmdc:mga0qj67_111932_c1 nmdc:mga0qj67_111932_c1_458_1159 229
134 3300050512 nmdc:mga0n895_1185736_c1 nmdc:mga0n895_1185736_c1_32_721 229
135 3300060353 Ga0501082_0041337 Ga0501082_0041337_2206_2898 229
136 3300060353 Ga0501082_0550827 Ga0501082_0550827_169_864 229
137 3300025922 Ga0207646_10205811 Ga0207646_102058112 237
138 2162886007 SwRhRL2b_contig_895287 SwRhRL2b_0232.00005200 238
139 3300005295 Ga0065707_10006223 Ga0065707_100062232 238

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gou-assembly1.cif.gz_K structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.9037 15 71
5gou-assembly1.cif.gz_E structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.9012 15 72
7cpc-assembly1.cif.gz_A his-mediated reversible self-assembly of ferritin nanocage with ni binding 0.8972 15 71
7dqp-assembly1.cif.gz_B-2 thermal treated marsupenaeus japonicus ferritin 0.8971 15 71
5gn8-assembly1.cif.gz_B structure of a 48-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.8955 15 71
ID Description Score Start End Superfamily
5gouK00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9037 15 71 1.20.1260.10
5gouO00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9034 15 71 1.20.1260.10
af_P42166_494_672_1.10.287.3160 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8792 19 72 1.10.287.3160
af_O95858_1_114_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.8713 18 71 1.20.120.350
af_Q54MC0_326_451_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8707 20 71 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A3B8JH06-F1-model_v4 B box-type domain-containing protein 0.9819 16 72 GO:0016020
AF-A0A3C0PA04-F1-model_v4 DUF2812 domain-containing protein 0.9723 16 71 GO:0016020
AF-A0A382XPY9-F1-model_v4 ABC-type uncharacterized transport system domain-containing protein 0.963 16 72 GO:0016020
AF-A0A2E7G754-F1-model_v4 deleted 0.9527 16 71
AF-A0A1F8MGX0-F1-model_v4 Uncharacterized protein 0.949 17 71 GO:0016020

Feature Viewer

pLDDT pTM Quality
82.15 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map