F174498
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 138 | 36 | 276 | 358 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0134791|Ga0501075_0134791_176_1369 |
| Length | 397 |
| Sequence | MAKVLMKGNEALGEAAIRAGCVHFFGYPITPQTEIPEYLVKRLPEVGGTFVQAESELAAINMVYGAAGVGVKCLTSSSSPGISLMAEGMSYLAACELPCVVVNIMRAGPGLGGILPSQSDYLQATRGHGHGDYRLIVLAPASVQEAVDLMIRAFELAEKYRTPVMLCADGMIGQMMEPVEFAGNGRGAPLGDNDWALTGRRNRPRRVVNSLYLAPEQLHQHNVHLQQKYAEIAAHEQRWELCHADQRYDLLLAAFGTMARICRTAIDEVRKDGLRVGLFRPITLSPFPFGPCRAAMDAMADDGRVLTVEMNMGQMVTDVKFAAEGTREVAFYGTAGGVIPSPDMVAATIREMLLSSRRLWAGTGLCVEAQGDGVPCPTVNGECESCGREQSAAGMSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 3 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 4 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 5 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 6 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 7 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 8 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 9 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 10 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 11 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 12 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 13 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 14 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 19 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 20 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 21 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 22 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 23 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 24 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 25 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 26 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 27 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 28 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 29 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 30 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 31 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 32 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 33 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 34 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 35 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.75 |
| Metatranscriptomes | 7.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.72 |
| Rhizosphere | 76.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501075_0134791 | 3300049591 | Bacteria | 1881 |
| 2 | Ga0157376_10067002 | 3300014969 | Bacteria | 3036 |
| 3 | Ga0265323_10010360 | 3300028653 | Bacteria | 3780 |
| 4 | Ga0265322_10008133 | 3300028654 | Bacteria | 3057 |
| 5 | Ga0265316_10000021 | 3300031344 | Bacteria | 185946 |
| 6 | Ga0265316_10000146 | 3300031344 | Bacteria | 77550 |
| 7 | Ga0265316_10006521 | 3300031344 | Bacteria | 11131 |
| 8 | Ga0316575_10000555 | 3300031665 | Bacteria | 10919 |
| 9 | Ga0316575_10000938 | 3300031665 | Bacteria | 8952 |
| 10 | Ga0316575_10007379 | 3300031665 | Bacteria | 3979 |
| 11 | Ga0316579_10000773 | 3300031691 | Bacteria | 10940 |
| 12 | Ga0316579_10053743 | 3300031691 | Bacteria | 1887 |
| 13 | Ga0316579_10093748 | 3300031691 | Bacteria | 1435 |
| 14 | Ga0316576_10000360 | 3300031727 | Bacteria | 20486 |
| 15 | Ga0316576_10000516 | 3300031727 | Bacteria | 18113 |
| 16 | Ga0316576_10000725 | 3300031727 | Bacteria | 16325 |
| 17 | Ga0316576_10000814 | 3300031727 | Bacteria | 15773 |
| 18 | Ga0316576_10001764 | 3300031727 | Bacteria | 11947 |
| 19 | Ga0316576_10002030 | 3300031727 | Bacteria | 11350 |
| 20 | Ga0316576_10006593 | 3300031727 | Bacteria | 7247 |
| 21 | Ga0316576_10007435 | 3300031727 | Bacteria | 6900 |
| 22 | Ga0316576_10009446 | 3300031727 | Bacteria | 6294 |
| 23 | Ga0316576_10036201 | 3300031727 | Bacteria | 3528 |
| 24 | Ga0316576_10036703 | 3300031727 | Bacteria | 3504 |
| 25 | Ga0316576_10050564 | 3300031727 | Bacteria | 3023 |
| 26 | Ga0316576_10054816 | 3300031727 | Bacteria | 2908 |
| 27 | Ga0316576_10082085 | 3300031727 | Bacteria | 2393 |
| 28 | Ga0316576_10157971 | 3300031727 | Unclassified | 1709 |
| 29 | Ga0316576_10159631 | 3300031727 | Bacteria | 1700 |
| 30 | Ga0316576_10195171 | 3300031727 | Bacteria | 1526 |
| 31 | Ga0316578_10028758 | 3300031728 | Bacteria | 3150 |
| 32 | Ga0316578_10043927 | 3300031728 | Bacteria | 2597 |
| 33 | Ga0316578_10047416 | 3300031728 | Bacteria | 2507 |
| 34 | Ga0316578_10049005 | 3300031728 | Bacteria | 2468 |
| 35 | Ga0316578_10070753 | 3300031728 | Bacteria | 2065 |
| 36 | Ga0316578_10073783 | 3300031728 | Bacteria | 2022 |
| 37 | Ga0316578_10083037 | 3300031728 | Bacteria | 1908 |
| 38 | Ga0316577_10000020 | 3300031733 | Bacteria | 35147 |
| 39 | Ga0316577_10006915 | 3300031733 | Bacteria | 6027 |
| 40 | Ga0316577_10011998 | 3300031733 | Bacteria | 4711 |
| 41 | Ga0316577_10019283 | 3300031733 | Bacteria | 3773 |
| 42 | Ga0316577_10034512 | 3300031733 | Bacteria | 2826 |
| 43 | Ga0316577_10133301 | 3300031733 | Bacteria | 1398 |
| 44 | Ga0316583_10001818 | 3300032133 | Bacteria | 7256 |
| 45 | Ga0316583_10001850 | 3300032133 | Bacteria | 7203 |
| 46 | Ga0316583_10002837 | 3300032133 | Bacteria | 6072 |
| 47 | Ga0316583_10003932 | 3300032133 | Bacteria | 5279 |
| 48 | Ga0316585_10000024 | 3300032137 | Bacteria | 22379 |
| 49 | Ga0316585_10012108 | 3300032137 | Bacteria | 2551 |
| 50 | Ga0316580_10000548 | 3300032139 | Bacteria | 8752 |
| 51 | Ga0316580_10006460 | 3300032139 | Bacteria | 3463 |
| 52 | Ga0316580_10006786 | 3300032139 | Unclassified | 3387 |
| 53 | Ga0316593_10046667 | 3300032168 | Bacteria | 1455 |
| 54 | Ga0316593_10048926 | 3300032168 | Bacteria | 1424 |
| 55 | Ga0316593_10053359 | 3300032168 | Bacteria | 1370 |
| 56 | Ga0316592_1006849 | 3300033524 | Bacteria | 2207 |
| 57 | Ga0316588_1021398 | 3300033528 | Bacteria | 1471 |
| 58 | Ga0316596_1009295 | 3300033541 | Bacteria | 2357 |
| 59 | Ga0316596_1013189 | 3300033541 | Bacteria | 2039 |
| 60 | Ga0316596_1017054 | 3300033541 | Bacteria | 1823 |
| 61 | Ga0316596_1019933 | 3300033541 | Bacteria | 1704 |
| 62 | Ga0316596_1023410 | 3300033541 | Bacteria | 1583 |
| 63 | Ga0316574_0000110 | 3300035398 | Bacteria | 24477 |
| 64 | Ga0316574_0003635 | 3300035398 | Bacteria | 7975 |
| 65 | Ga0316574_0008194 | 3300035398 | Bacteria | 5787 |
| 66 | Ga0316574_0012288 | 3300035398 | Bacteria | 4896 |
| 67 | Ga0316574_0059544 | 3300035398 | Bacteria | 2395 |
| 68 | Ga0316574_0182361 | 3300035398 | Bacteria | 1350 |
| 69 | Ga0316582_0000077 | 3300036647 | Bacteria | 25182 |
| 70 | Ga0316582_0000121 | 3300036647 | Bacteria | 22350 |
| 71 | Ga0316582_0003041 | 3300036647 | Bacteria | 8092 |
| 72 | Ga0316582_0010903 | 3300036647 | Bacteria | 5002 |
| 73 | Ga0316582_0012536 | 3300036647 | Bacteria | 4736 |
| 74 | Ga0316582_0018515 | 3300036647 | Bacteria | 4055 |
| 75 | Ga0316582_0028241 | 3300036647 | Bacteria | 3397 |
| 76 | Ga0316582_0047600 | 3300036647 | Bacteria | 2708 |
| 77 | Ga0316582_0105814 | 3300036647 | Bacteria | 1868 |
| 78 | Ga0316582_0163699 | 3300036647 | Bacteria | 1507 |
| 79 | Ga0316584_0000763 | 3300036712 | Bacteria | 17957 |
| 80 | Ga0316584_0001037 | 3300036712 | Bacteria | 16129 |
| 81 | Ga0316584_0001680 | 3300036712 | Bacteria | 13527 |
| 82 | Ga0316584_0002460 | 3300036712 | Bacteria | 11719 |
| 83 | Ga0316584_0009733 | 3300036712 | Bacteria | 6688 |
| 84 | Ga0316584_0015953 | 3300036712 | Bacteria | 5381 |
| 85 | Ga0316584_0034422 | 3300036712 | Bacteria | 3755 |
| 86 | Ga0316584_0055341 | 3300036712 | Bacteria | 2970 |
| 87 | Ga0316584_0070104 | 3300036712 | Bacteria | 2628 |
| 88 | Ga0316584_0117732 | 3300036712 | Bacteria | 1987 |
| 89 | Ga0316584_0135583 | 3300036712 | Unclassified | 1837 |
| 90 | Ga0316584_0157892 | 3300036712 | Bacteria | 1686 |
| 91 | Ga0316584_0243970 | 3300036712 | Bacteria | 1314 |
| 92 | Ga0316581_0004098 | 3300037588 | Unclassified | 3685 |
| 93 | Ga0316581_0035684 | 3300037588 | Bacteria | 1507 |
| 94 | Ga0400484_24180 | 3300038725 | Bacteria | 2631 |
| 95 | Ga0400484_28197 | 3300038725 | Bacteria | 19326 |
| 96 | Ga0400484_36831 | 3300038725 | Bacteria | 14260 |
| 97 | Ga0400490_06651 | 3300038726 | Bacteria | 44225 |
| 98 | Ga0400490_19578 | 3300038726 | Bacteria | 1773 |
| 99 | Ga0400490_33975 | 3300038726 | Bacteria | 4023 |
| 100 | Ga0400490_35087 | 3300038726 | Bacteria | 6779 |
| 101 | Ga0400490_58021 | 3300038726 | Bacteria | 28721 |
| 102 | Ga0400485_09394 | 3300038735 | Bacteria | 31894 |
| 103 | Ga0400485_12791 | 3300038735 | Bacteria | 25460 |
| 104 | Ga0400485_18422 | 3300038735 | Bacteria | 32961 |
| 105 | Ga0400485_18722 | 3300038735 | Bacteria | 12083 |
| 106 | Ga0400488_20310 | 3300038741 | Bacteria | 6096 |
| 107 | Ga0400486_07564 | 3300038742 | Bacteria | 6573 |
| 108 | Ga0400486_18425 | 3300038742 | Bacteria | 17295 |
| 109 | Ga0400486_18753 | 3300038742 | Bacteria | 46597 |
| 110 | Ga0400486_19779 | 3300038742 | Bacteria | 39072 |
| 111 | Ga0400483_061917 | 3300039062 | Bacteria | 4794 |
| 112 | Ga0400483_097471 | 3300039062 | Bacteria | 9551 |
| 113 | Ga0400483_176499 | 3300039062 | Bacteria | 8033 |
| 114 | Ga0400483_195000 | 3300039062 | Bacteria | 103610 |
| 115 | Ga0400483_195564 | 3300039062 | Bacteria | 8910 |
| 116 | Ga0400489_18127 | 3300039093 | Bacteria | 2091 |
| 117 | Ga0400489_19840 | 3300039093 | Bacteria | 22846 |
| 118 | Ga0400489_62086 | 3300039093 | Bacteria | 14747 |
| 119 | Ga0400489_77515 | 3300039093 | Bacteria | 15547 |
| 120 | Ga0400489_78220 | 3300039093 | Bacteria | 1582 |
| 121 | Ga0400489_93966 | 3300039093 | Bacteria | 37739 |
| 122 | Ga0400487_01631 | 3300039110 | Bacteria | 32665 |
| 123 | Ga0400487_24787 | 3300039110 | Bacteria | 2420 |
| 124 | Ga0400487_64491 | 3300039110 | Unclassified | 3138 |
| 125 | Ga0451795_1091601 | 3300041456 | Bacteria | 2111 |
| 126 | Ga0451577_0053781 | 3300042876 | Bacteria | 3594 |
| 127 | Ga0453683_0016017 | 3300044673 | Unclassified | 4844 |
| 128 | Ga0453683_0128581 | 3300044673 | Bacteria | 1596 |
| 129 | Ga0453684_0001030 | 3300044712 | Bacteria | 89069 |
| 130 | Ga0453684_0001369 | 3300044712 | Bacteria | 70779 |
| 131 | Ga0453684_0008196 | 3300044712 | Bacteria | 18843 |
| 132 | Ga0453684_0016180 | 3300044712 | Bacteria | 11693 |
| 133 | Ga0453684_0065127 | 3300044712 | Bacteria | 4649 |
| 134 | Ga0453684_0089354 | 3300044712 | Bacteria | 3811 |
| 135 | Ga0453684_0394197 | 3300044712 | Bacteria | 1552 |
| 136 | Ga0451576_0234899 | 3300045051 | Bacteria | 1915 |
| 137 | Ga0495628_0082629 | 3300046516 | Bacteria | 2495 |
| 138 | Ga0495684_0148431 | 3300047471 | Bacteria | 1754 |
| 139 | Ga0501075_0134791 | |||
| 140 | Ga0157376_10067002 | |||
| 141 | Ga0265323_10010360 | |||
| 142 | Ga0265322_10008133 | |||
| 143 | Ga0265316_10000021 | |||
| 144 | Ga0265316_10000146 | |||
| 145 | Ga0265316_10006521 | |||
| 146 | Ga0316575_10000555 | |||
| 147 | Ga0316575_10000938 | |||
| 148 | Ga0316575_10007379 | |||
| 149 | Ga0316579_10000773 | |||
| 150 | Ga0316579_10053743 | |||
| 151 | Ga0316579_10093748 | |||
| 152 | Ga0316576_10000360 | |||
| 153 | Ga0316576_10000516 | |||
| 154 | Ga0316576_10000725 | |||
| 155 | Ga0316576_10000814 | |||
| 156 | Ga0316576_10001764 | |||
| 157 | Ga0316576_10002030 | |||
| 158 | Ga0316576_10006593 | |||
| 159 | Ga0316576_10007435 | |||
| 160 | Ga0316576_10009446 | |||
| 161 | Ga0316576_10036201 | |||
| 162 | Ga0316576_10036703 | |||
| 163 | Ga0316576_10050564 | |||
| 164 | Ga0316576_10054816 | |||
| 165 | Ga0316576_10082085 | |||
| 166 | Ga0316576_10157971 | |||
| 167 | Ga0316576_10159631 | |||
| 168 | Ga0316576_10195171 | |||
| 169 | Ga0316578_10028758 | |||
| 170 | Ga0316578_10043927 | |||
| 171 | Ga0316578_10047416 | |||
| 172 | Ga0316578_10049005 | |||
| 173 | Ga0316578_10070753 | |||
| 174 | Ga0316578_10073783 | |||
| 175 | Ga0316578_10083037 | |||
| 176 | Ga0316577_10000020 | |||
| 177 | Ga0316577_10006915 | |||
| 178 | Ga0316577_10011998 | |||
| 179 | Ga0316577_10019283 | |||
| 180 | Ga0316577_10034512 | |||
| 181 | Ga0316577_10133301 | |||
| 182 | Ga0316583_10001818 | |||
| 183 | Ga0316583_10001850 | |||
| 184 | Ga0316583_10002837 | |||
| 185 | Ga0316583_10003932 | |||
| 186 | Ga0316585_10000024 | |||
| 187 | Ga0316585_10012108 | |||
| 188 | Ga0316580_10000548 | |||
| 189 | Ga0316580_10006460 | |||
| 190 | Ga0316580_10006786 | |||
| 191 | Ga0316593_10046667 | |||
| 192 | Ga0316593_10048926 | |||
| 193 | Ga0316593_10053359 | |||
| 194 | Ga0316592_1006849 | |||
| 195 | Ga0316588_1021398 | |||
| 196 | Ga0316596_1009295 | |||
| 197 | Ga0316596_1013189 | |||
| 198 | Ga0316596_1017054 | |||
| 199 | Ga0316596_1019933 | |||
| 200 | Ga0316596_1023410 | |||
| 201 | Ga0316574_0000110 | |||
| 202 | Ga0316574_0003635 | |||
| 203 | Ga0316574_0008194 | |||
| 204 | Ga0316574_0012288 | |||
| 205 | Ga0316574_0059544 | |||
| 206 | Ga0316574_0182361 | |||
| 207 | Ga0316582_0000077 | |||
| 208 | Ga0316582_0000121 | |||
| 209 | Ga0316582_0003041 | |||
| 210 | Ga0316582_0010903 | |||
| 211 | Ga0316582_0012536 | |||
| 212 | Ga0316582_0018515 | |||
| 213 | Ga0316582_0028241 | |||
| 214 | Ga0316582_0047600 | |||
| 215 | Ga0316582_0105814 | |||
| 216 | Ga0316582_0163699 | |||
| 217 | Ga0316584_0000763 | |||
| 218 | Ga0316584_0001037 | |||
| 219 | Ga0316584_0001680 | |||
| 220 | Ga0316584_0002460 | |||
| 221 | Ga0316584_0009733 | |||
| 222 | Ga0316584_0015953 | |||
| 223 | Ga0316584_0034422 | |||
| 224 | Ga0316584_0055341 | |||
| 225 | Ga0316584_0070104 | |||
| 226 | Ga0316584_0117732 | |||
| 227 | Ga0316584_0135583 | |||
| 228 | Ga0316584_0157892 | |||
| 229 | Ga0316584_0243970 | |||
| 230 | Ga0316581_0004098 | |||
| 231 | Ga0316581_0035684 | |||
| 232 | Ga0400484_24180 | |||
| 233 | Ga0400484_28197 | |||
| 234 | Ga0400484_36831 | |||
| 235 | Ga0400490_06651 | |||
| 236 | Ga0400490_19578 | |||
| 237 | Ga0400490_33975 | |||
| 238 | Ga0400490_35087 | |||
| 239 | Ga0400490_58021 | |||
| 240 | Ga0400485_09394 | |||
| 241 | Ga0400485_12791 | |||
| 242 | Ga0400485_18422 | |||
| 243 | Ga0400485_18722 | |||
| 244 | Ga0400488_20310 | |||
| 245 | Ga0400486_07564 | |||
| 246 | Ga0400486_18425 | |||
| 247 | Ga0400486_18753 | |||
| 248 | Ga0400486_19779 | |||
| 249 | Ga0400483_061917 | |||
| 250 | Ga0400483_097471 | |||
| 251 | Ga0400483_176499 | |||
| 252 | Ga0400483_195000 | |||
| 253 | Ga0400483_195564 | |||
| 254 | Ga0400489_18127 | |||
| 255 | Ga0400489_19840 | |||
| 256 | Ga0400489_62086 | |||
| 257 | Ga0400489_77515 | |||
| 258 | Ga0400489_78220 | |||
| 259 | Ga0400489_93966 | |||
| 260 | Ga0400487_01631 | |||
| 261 | Ga0400487_24787 | |||
| 262 | Ga0400487_64491 | |||
| 263 | Ga0451795_1091601 | |||
| 264 | Ga0451577_0053781 | |||
| 265 | Ga0453683_0016017 | |||
| 266 | Ga0453683_0128581 | |||
| 267 | Ga0453684_0001030 | |||
| 268 | Ga0453684_0001369 | |||
| 269 | Ga0453684_0008196 | |||
| 270 | Ga0453684_0016180 | |||
| 271 | Ga0453684_0065127 | |||
| 272 | Ga0453684_0089354 | |||
| 273 | Ga0453684_0394197 | |||
| 274 | Ga0451576_0234899 | |||
| 275 | Ga0495628_0082629 | |||
| 276 | Ga0495684_0148431 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yd7-assembly1.cif.gz_A | conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus | 0.9396 | 2 | 183 |
| 4wbx-assembly1.cif.gz_C | conserved hypothetical protein pf1771 from pyrococcus furiosus solved by sulfur sad using swiss light source data | 0.9173 | 2 | 348 |
| 4wbx-assembly1.cif.gz_C | conserved hypothetical protein pf1771 from pyrococcus furiosus solved by sulfur sad using swiss light source data | 0.8905 | 2 | 348 |
| 1yd7-assembly1.cif.gz_A | conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus | 0.8431 | 2 | 183 |
| 6n2o-assembly1.cif.gz_C | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.8399 | 2 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yd7A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9395 | 2 | 183 | 3.40.50.970 |
| af_Q57724_1_190_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.908 | 1 | 189 | 3.40.50.970 |
| af_Q57724_1_190_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8988 | 1 | 189 | 3.40.50.970 |
| af_O53182_237_440_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8974 | 3 | 183 | 3.40.50.970 |
| af_Q57724_260_365_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.895 | 238 | 349 | 3.40.50.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351JXP1-F1-model_v4 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | 0.9905 | 6 | 104 |
GO:0016491
|
| AF-A0A3D3CJU9-F1-model_v4 | 2-oxoacid:acceptor oxidoreductase subunit alpha (EC 1.2.7.3) | 0.9847 | 6 | 104 |
GO:0006979
GO:0047553 |
| AF-A0A7V5W674-F1-model_v4 | 2-oxoacid:acceptor oxidoreductase subunit alpha (EC 1.2.7.3) | 0.9819 | 6 | 104 |
GO:0006979
GO:0047553 |
| AF-A0A3D5U790-F1-model_v4 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | 0.97 | 1 | 108 |
GO:0016491
|
| AF-A0A7Y3FWY1-F1-model_v4 | 2-oxoacid:acceptor oxidoreductase subunit alpha | 0.9669 | 4 | 103 |
GO:0006979
GO:0016903 |