F174299

General Info

Members Datasets Scaffolds Average Seq Length
138 99 138 142

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0452900|Ga0496108_0452900_440_916
Length 158
Sequence MGQPRKEVSVSSSAPVRVLVVANRTAATPALLEAVRARAASGPTVFSLLVPASAHGISRIADPEDDADVSEAQSSLDLALPLLEEAAGGPVEGLVGDPDPFLAVSDAVNVRGFDELIISTLSPRVSRWLRLDLPRRLKVLGIPITTVTAKGAQVVSTG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
99 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.97
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006023 3300003203 Bacteria 5609
2 Ga0070658_10346093 3300005327 Bacteria 1272
3 Ga0070683_100180087 3300005329 Bacteria 2006
4 Ga0070682_100539038 3300005337 Bacteria 911
5 Ga0070660_100714326 3300005339 Bacteria 841
6 Ga0070709_10299204 3300005434 Bacteria 1175
7 Ga0070709_11064655 3300005434 Bacteria 646
8 Ga0070714_100433402 3300005435 Bacteria 1247
9 Ga0070713_100401529 3300005436 Bacteria 1280
10 Ga0070713_102015328 3300005436 Bacteria 560
11 Ga0070710_10872125 3300005437 Bacteria 648
12 Ga0070710_10976963 3300005437 Bacteria 616
13 Ga0070711_100357275 3300005439 Bacteria 1176
14 Ga0070711_100363785 3300005439 Bacteria 1166
15 Ga0070711_101156774 3300005439 Unclassified 668
16 Ga0070700_100508760 3300005441 Bacteria 928
17 Ga0070663_100321850 3300005455 Bacteria 1244
18 Ga0070665_100022661 3300005548 Bacteria 6324
19 Ga0070665_101870901 3300005548 Bacteria 606
20 Ga0068854_100693910 3300005578 Bacteria 878
21 Ga0068856_101467068 3300005614 Bacteria 696
22 Ga0068863_101239966 3300005841 Bacteria 752
23 Ga0081538_10227301 3300005981 Bacteria 733
24 Ga0081539_10010674 3300005985 Bacteria 7409
25 Ga0070717_10524770 3300006028 Bacteria 1071
26 Ga0070715_10266688 3300006163 Bacteria 902
27 Ga0070716_100280948 3300006173 Bacteria 1149
28 Ga0070712_100024225 3300006175 Bacteria 4019
29 Ga0070712_100593724 3300006175 Bacteria 937
30 Ga0070712_100788659 3300006175 Bacteria 815
31 Ga0070712_101067607 3300006175 Unclassified 700
32 Ga0105242_10966855 3300009176 Bacteria 857
33 Ga0105242_11829558 3300009176 Bacteria 646
34 Ga0105237_10002436 3300009545 Bacteria 23091
35 Ga0105249_11743153 3300009553 Bacteria 695
36 Ga0157378_10240563 3300013297 Unclassified 1729
37 Ga0163162_11051430 3300013306 Bacteria 921
38 Ga0157372_11215776 3300013307 Bacteria 871
39 Ga0157372_11674427 3300013307 Bacteria 732
40 Ga0157380_10628680 3300014326 Bacteria 1067
41 Ga0206356_11255847 3300020070 Unclassified 559
42 Ga0207692_10280033 3300025898 Bacteria 1009
43 Ga0207692_10667504 3300025898 Bacteria 673
44 Ga0207699_10371276 3300025906 Bacteria 1014
45 Ga0207695_10009283 3300025913 Bacteria 12180
46 Ga0207671_10001250 3300025914 Bacteria 29955
47 Ga0207693_10070228 3300025915 Bacteria 2741
48 Ga0207693_10851047 3300025915 Bacteria 701
49 Ga0207693_10873601 3300025915 Unclassified 691
50 Ga0207693_11084960 3300025915 Unclassified 609
51 Ga0207663_10174714 3300025916 Bacteria 1529
52 Ga0207657_10546930 3300025919 Bacteria 905
53 Ga0207700_10034672 3300025928 Unclassified 3626
54 Ga0207686_11000404 3300025934 Bacteria 678
55 Ga0207669_10686108 3300025937 Bacteria 841
56 Ga0207665_10106018 3300025939 Unclassified 1969
57 Ga0207665_10322104 3300025939 Bacteria 1160
58 Ga0207661_10036116 3300025944 Bacteria 3856
59 Ga0207679_10226215 3300025945 Bacteria 1576
60 Ga0207679_10567110 3300025945 Bacteria 1020
61 Ga0207658_10693593 3300025986 Bacteria 920
62 Ga0207641_11589894 3300026088 Bacteria 656
63 Ga0268266_10105717 3300028379 Bacteria 2487
64 Ga0265337_1002052 3300028556 Bacteria 9529
65 Ga0265326_10000408 3300028558 Bacteria 17222
66 Ga0265319_1000214 3300028563 Bacteria 43892
67 Ga0265319_1091377 3300028563 Bacteria 960
68 Ga0265318_10006548 3300028577 Bacteria 5348
69 Ga0265318_10074891 3300028577 Bacteria 1253
70 Ga0265322_10043918 3300028654 Unclassified 1272
71 Ga0265336_10000043 3300028666 Bacteria 132135
72 Ga0265336_10015005 3300028666 Bacteria 2558
73 Ga0265338_10000142 3300028800 Bacteria 132135
74 Ga0265338_10224840 3300028800 Unclassified 1400
75 Ga0265324_10008424 3300029957 Bacteria 4097
76 Ga0265320_10207881 3300031240 Bacteria 873
77 Ga0265320_10269627 3300031240 Unclassified 754
78 Ga0265325_10038018 3300031241 Unclassified 2542
79 Ga0265340_10000006 3300031247 Bacteria 132135
80 Ga0265339_10085620 3300031249 Unclassified 1659
81 Ga0265327_10014206 3300031251 Bacteria 5222
82 Ga0265327_10031824 3300031251 Bacteria 2960
83 Ga0265316_10077209 3300031344 Unclassified 2558
84 Ga0265314_10198180 3300031711 Unclassified 1189
85 Ga0307413_10610613 3300031824 Bacteria 894
86 Ga0307414_10034504 3300032004 Bacteria 3356
87 Ga0307411_10559953 3300032005 Bacteria 977
88 Ga0373937_1564717 3300036401 Bacteria 607
89 Ga0373925_0420649 3300037068 Unclassified 1092
90 Ga0395899_0562439 3300037312 Bacteria 731
91 Ga0395899_0730769 3300037312 Bacteria 618
92 Ga0395900_1457444 3300037418 Bacteria 597
93 Ga0395898_0091076 3300037466 Bacteria 2934
94 Ga0395898_0288910 3300037466 Bacteria 1564
95 Ga0395905_0189887 3300037471 Bacteria 1927
96 Ga0436364_0006323 3300037853 Bacteria 823
97 Ga0395901_0043753 3300038443 Bacteria 4644
98 Ga0395901_0105616 3300038443 Bacteria 2956
99 Ga0395901_0176269 3300038443 Bacteria 2243
100 Ga0436365_0333294 3300039437 Bacteria 971
101 Ga0466963_0236988 3300044694 Bacteria 1279
102 Ga0466960_0018696 3300044901 Bacteria 3042
103 Ga0466960_0069663 3300044901 Unclassified 1748
104 Ga0466960_0082364 3300044901 Bacteria 1624
105 Ga0466960_0421911 3300044901 Bacteria 771
106 Ga0495644_0168898 3300046523 Bacteria 840
107 Ga0495645_0000145 3300046543 Bacteria 48403
108 Ga0495656_0341521 3300046615 Bacteria 774
109 Ga0495668_0630077 3300046616 Bacteria 593
110 Ga0495646_0092618 3300046680 Bacteria 1743
111 Ga0495646_0429696 3300046680 Bacteria 684
112 Ga0495670_0702417 3300046691 Bacteria 552
113 Ga0495604_0001043 3300047317 Bacteria 23044
114 Ga0495604_0817609 3300047317 Bacteria 586
115 Ga0495684_0007217 3300047471 Bacteria 8625
116 Ga0495684_0569671 3300047471 Bacteria 768
117 Ga0496100_0002020 3300048903 Bacteria 10153
118 Ga0496103_0413300 3300048906 Unclassified 866
119 Ga0496104_0507884 3300048907 Bacteria 1117
120 Ga0496104_0876055 3300048907 Bacteria 803
121 Ga0496104_1667905 3300048907 Bacteria 540
122 Ga0496108_0212234 3300048911 Bacteria 1681
123 Ga0496108_0452900 3300048911 Unclassified 1121
124 Ga0496109_0610817 3300048912 Bacteria 1027
125 Ga0496109_1005607 3300048912 Bacteria 771
126 Ga0496110_0045158 3300048913 Bacteria 3850
127 Ga0496111_0077873 3300048914 Bacteria 2417
128 Ga0496121_0020927 3300048924 Bacteria 6438
129 Ga0501032_0009413 3300049569 Bacteria 7079
130 Ga0501034_0014470 3300049571 Bacteria 8124
131 Ga0501034_1002406 3300049571 Bacteria 719
132 Ga0501047_0618644 3300049581 Unclassified 904
133 nmdc:mga08y16_1308359_c1 3300050511 Bacteria 691
134 nmdc:mga08y16_147091_c1 3300050511 Unclassified 2449
135 nmdc:mga0n895_1634727_c1 3300050512 Bacteria 608
136 nmdc:mga0rr50_1105620_c1 3300050513 Bacteria 674
137 Ga0495612_0310430 3300053078 Bacteria 708
138 Ga0495619_0766066 3300053085 Bacteria 654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0876055 Ga0496104_0876055_459_788 88
2 3300025944 Ga0207661_10036116 Ga0207661_100361163 94
3 3300025945 Ga0207679_10226215 Ga0207679_102262152 94
4 3300048911 Ga0496108_0212234 Ga0496108_0212234_1166_1612 94
5 3300048912 Ga0496109_1005607 Ga0496109_1005607_294_740 94
6 3300048913 Ga0496110_0045158 Ga0496110_0045158_470_916 94
7 3300048914 Ga0496111_0077873 Ga0496111_0077873_1678_2124 94
8 3300044901 Ga0466960_0082364 Ga0466960_0082364_49_498 103
9 3300005337 Ga0070682_100539038 Ga0070682_1005390382 104
10 3300044694 Ga0466963_0236988 Ga0466963_0236988_326_772 105
11 3300046615 Ga0495656_0341521 Ga0495656_0341521_119_565 105
12 3300046691 Ga0495670_0702417 Ga0495670_0702417_18_464 105
13 3300005455 Ga0070663_100321850 Ga0070663_1003218502 106
14 3300025937 Ga0207669_10686108 Ga0207669_106861083 106
15 3300049571 Ga0501034_0014470 Ga0501034_0014470_6043_6492 106
16 3300046523 Ga0495644_0168898 Ga0495644_0168898_73_528 107
17 3300048907 Ga0496104_1667905 Ga0496104_1667905_51_506 108
18 3300025945 Ga0207679_10567110 Ga0207679_105671101 109
19 3300037418 Ga0395900_1457444 Ga0395900_1457444_30_479 109
20 3300037466 Ga0395898_0288910 Ga0395898_0288910_567_1016 109
21 3300038443 Ga0395901_0105616 Ga0395901_0105616_775_1224 109
22 3300025934 Ga0207686_11000404 Ga0207686_110004042 110
23 3300037312 Ga0395899_0562439 Ga0395899_0562439_37_495 111
24 3300037466 Ga0395898_0091076 Ga0395898_0091076_2113_2571 111
25 3300037471 Ga0395905_0189887 Ga0395905_0189887_617_1075 111
26 3300038443 Ga0395901_0043753 Ga0395901_0043753_3396_3854 111
27 3300053085 Ga0495619_0766066 Ga0495619_0766066_158_562 113
28 3300047317 Ga0495604_0817609 Ga0495604_0817609_158_565 114
29 3300005841 Ga0068863_101239966 Ga0068863_1012399662 116
30 3300046616 Ga0495668_0630077 Ga0495668_0630077_165_578 116
31 3300046680 Ga0495646_0092618 Ga0495646_0092618_405_818 116
32 3300047317 Ga0495604_0001043 Ga0495604_0001043_11290_11703 116
33 3300047471 Ga0495684_0569671 Ga0495684_0569671_146_559 116
34 3300028563 Ga0265319_1091377 Ga0265319_10913773 119
35 3300028577 Ga0265318_10074891 Ga0265318_100748913 119
36 3300028666 Ga0265336_10015005 Ga0265336_100150054 119
37 3300031240 Ga0265320_10207881 Ga0265320_102078813 119
38 3300031251 Ga0265327_10014206 Ga0265327_100142068 119
39 3300044901 Ga0466960_0018696 Ga0466960_0018696_873_1295 119
40 3300044901 Ga0466960_0069663 Ga0466960_0069663_1291_1713 119
41 3300044901 Ga0466960_0421911 Ga0466960_0421911_71_493 119
42 3300005434 Ga0070709_10299204 Ga0070709_102992043 120
43 3300005436 Ga0070713_100401529 Ga0070713_1004015293 120
44 3300005437 Ga0070710_10976963 Ga0070710_109769632 120
45 3300005981 Ga0081538_10227301 Ga0081538_102273012 120
46 3300009545 Ga0105237_10002436 Ga0105237_1000243623 120
47 3300013307 Ga0157372_11674427 Ga0157372_116744272 120
48 3300014326 Ga0157380_10628680 Ga0157380_106286801 120
49 3300025898 Ga0207692_10667504 Ga0207692_106675042 120
50 3300025906 Ga0207699_10371276 Ga0207699_103712762 120
51 3300025913 Ga0207695_10009283 Ga0207695_1000928313 120
52 3300025914 Ga0207671_10001250 Ga0207671_1000125017 120
53 3300025915 Ga0207693_10851047 Ga0207693_108510472 120
54 3300047471 Ga0495684_0007217 Ga0495684_0007217_2113_2541 120
55 3300048903 Ga0496100_0002020 Ga0496100_0002020_1510_1941 120
56 3300053078 Ga0495612_0310430 Ga0495612_0310430_54_479 120
57 3300005329 Ga0070683_100180087 Ga0070683_1001800871 121
58 3300005435 Ga0070714_100433402 Ga0070714_1004334022 121
59 3300005436 Ga0070713_102015328 Ga0070713_1020153281 121
60 3300005437 Ga0070710_10872125 Ga0070710_108721251 121
61 3300005439 Ga0070711_100357275 Ga0070711_1003572753 121
62 3300005439 Ga0070711_100363785 Ga0070711_1003637853 121
63 3300005548 Ga0070665_101870901 Ga0070665_1018709011 121
64 3300006163 Ga0070715_10266688 Ga0070715_102666881 121
65 3300006173 Ga0070716_100280948 Ga0070716_1002809482 121
66 3300006175 Ga0070712_100024225 Ga0070712_1000242252 121
67 3300006175 Ga0070712_100788659 Ga0070712_1007886592 121
68 3300020070 Ga0206356_11255847 Ga0206356_112558471 121
69 3300025915 Ga0207693_10070228 Ga0207693_100702286 121
70 3300025916 Ga0207663_10174714 Ga0207663_101747144 121
71 3300025939 Ga0207665_10322104 Ga0207665_103221042 121
72 3300036401 Ga0373937_1564717 Ga0373937_1564717_138_566 121
73 3300005439 Ga0070711_101156774 Ga0070711_1011567741 122
74 3300039437 Ga0436365_0333294 Ga0436365_0333294_17_454 123
75 3300005434 Ga0070709_11064655 Ga0070709_110646552 124
76 3300006175 Ga0070712_100593724 Ga0070712_1005937242 124
77 3300009176 Ga0105242_11829558 Ga0105242_118295582 124
78 3300013297 Ga0157378_10240563 Ga0157378_102405631 124
79 3300025898 Ga0207692_10280033 Ga0207692_102800332 124
80 3300025915 Ga0207693_10873601 Ga0207693_108736012 124
81 3300025915 Ga0207693_11084960 Ga0207693_110849601 124
82 3300025928 Ga0207700_10034672 Ga0207700_100346723 124
83 3300025939 Ga0207665_10106018 Ga0207665_101060182 124
84 3300028556 Ga0265337_1002052 Ga0265337_10020527 124
85 3300028558 Ga0265326_10000408 Ga0265326_1000040814 124
86 3300028563 Ga0265319_1000214 Ga0265319_10002142 124
87 3300028577 Ga0265318_10006548 Ga0265318_100065486 124
88 3300028654 Ga0265322_10043918 Ga0265322_100439183 124
89 3300028666 Ga0265336_10000043 Ga0265336_1000004354 124
90 3300028800 Ga0265338_10000142 Ga0265338_1000014295 124
91 3300029957 Ga0265324_10008424 Ga0265324_100084246 124
92 3300031240 Ga0265320_10269627 Ga0265320_102696272 124
93 3300031241 Ga0265325_10038018 Ga0265325_100380184 124
94 3300031247 Ga0265340_10000006 Ga0265340_1000000654 124
95 3300031249 Ga0265339_10085620 Ga0265339_100856203 124
96 3300031251 Ga0265327_10031824 Ga0265327_100318244 124
97 3300031344 Ga0265316_10077209 Ga0265316_100772092 124
98 3300031711 Ga0265314_10198180 Ga0265314_101981802 124
99 3300032004 Ga0307414_10034504 Ga0307414_100345045 124
100 3300037853 Ga0436364_0006323 Ga0436364_0006323_119_559 124
101 3300038443 Ga0395901_0176269 Ga0395901_0176269_1658_2083 124
102 3300050511 nmdc:mga08y16_147091_c1 nmdc:mga08y16_147091_c1_1640_2065 124
103 3300050512 nmdc:mga0n895_1634727_c1 nmdc:mga0n895_1634727_c1_151_591 124
104 3300050513 nmdc:mga0rr50_1105620_c1 nmdc:mga0rr50_1105620_c1_146_586 124
105 3300049571 Ga0501034_1002406 Ga0501034_1002406_13_453 125
106 3300049581 Ga0501047_0618644 Ga0501047_0618644_71_511 125
107 3300005339 Ga0070660_100714326 Ga0070660_1007143262 126
108 3300005441 Ga0070700_100508760 Ga0070700_1005087602 126
109 3300005578 Ga0068854_100693910 Ga0068854_1006939102 126
110 3300009176 Ga0105242_10966855 Ga0105242_109668553 126
111 3300009553 Ga0105249_11743153 Ga0105249_117431532 126
112 3300025919 Ga0207657_10546930 Ga0207657_105469302 126
113 3300026088 Ga0207641_11589894 Ga0207641_115898942 126
114 3300032005 Ga0307411_10559953 Ga0307411_105599532 126
115 3300049569 Ga0501032_0009413 Ga0501032_0009413_526_969 126
116 3300050511 nmdc:mga08y16_1308359_c1 nmdc:mga08y16_1308359_c1_136_582 126
117 3300006028 Ga0070717_10524770 Ga0070717_105247702 127
118 3300006175 Ga0070712_101067607 Ga0070712_1010676071 127
119 3300028800 Ga0265338_10224840 Ga0265338_102248402 127
120 3300048911 Ga0496108_0452900 Ga0496108_0452900_440_916 127
121 3300048924 Ga0496121_0020927 Ga0496121_0020927_5280_5726 127
122 3300003203 JGI25406J46586_10006023 JGI25406J46586_100060238 128
123 3300005327 Ga0070658_10346093 Ga0070658_103460931 128
124 3300005548 Ga0070665_100022661 Ga0070665_1000226615 128
125 3300005614 Ga0068856_101467068 Ga0068856_1014670682 128
126 3300005985 Ga0081539_10010674 Ga0081539_100106745 128
127 3300013306 Ga0163162_11051430 Ga0163162_110514302 128
128 3300013307 Ga0157372_11215776 Ga0157372_112157761 128
129 3300025986 Ga0207658_10693593 Ga0207658_106935932 128
130 3300028379 Ga0268266_10105717 Ga0268266_101057173 128
131 3300031824 Ga0307413_10610613 Ga0307413_106106131 128
132 3300037068 Ga0373925_0420649 Ga0373925_0420649_528_980 128
133 3300037312 Ga0395899_0730769 Ga0395899_0730769_115_600 128
134 3300046543 Ga0495645_0000145 Ga0495645_0000145_14616_15080 128
135 3300046680 Ga0495646_0429696 Ga0495646_0429696_29_481 128
136 3300048906 Ga0496103_0413300 Ga0496103_0413300_154_723 128
137 3300048907 Ga0496104_0507884 Ga0496104_0507884_450_902 128
138 3300048912 Ga0496109_0610817 Ga0496109_0610817_337_795 128

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iel-assembly1.cif.gz_A crystal structure of tt0030 from thermus thermophilus 0.8245 7 118
2iel-assembly1.cif.gz_B crystal structure of tt0030 from thermus thermophilus 0.7755 8 118
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.7325 6 118
2iel-assembly1.cif.gz_A crystal structure of tt0030 from thermus thermophilus 0.7228 7 118
6ulw-assembly1.cif.gz_C adenylation, ketoreductase, and pseudo asub multidomain structure of a keto acid-selecting nrps module 0.7009 6 89
ID Description Score Start End Superfamily
2ielB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7755 8 118 3.40.50.620
af_Q9VVU7_1_266_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7345 73 119 3.40.50.2300
4inaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7031 7 116 3.40.50.720
af_Q94II5_28_177_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7031 1 121 3.40.50.620
af_Q84WB7_514_757_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7 6 72 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7J9YX56-F1-model_v4 Universal stress protein 0.9368 1 118
AF-A0A838PNH8-F1-model_v4 UspA domain-containing protein 0.9267 11 119
AF-A0A538K9M7-F1-model_v4 Universal stress protein 0.9228 6 118
AF-A0A2W6BZM4-F1-model_v4 Universal stress protein 0.9191 6 118
AF-A0A7V9HBV1-F1-model_v4 Universal stress protein 0.9035 27 121

Feature Viewer

pLDDT pTM Quality
76.85 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map