F174244

General Info

Members Datasets Scaffolds Average Seq Length
138 111 276 156

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0301958|Ga0495675_0301958_283_822
Length 179
Sequence VKAREPDLMTAHPSPAGGWTLRPALPSDVEPIAELRAVVLRDDLERLGRYDERRVRQRLRDGFLPQYTSVVLAGGPEHGAEAGAGEPAGCVTLRPADGGGLWLEHFYLAPRLQGRGLGSAVLRSLLQRTDADGVPVRMIVLQGSAAQRLYERHGFTVEAEDPIDVRLVRPPAGRAHSGR

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
7 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
8 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
9 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
13 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
14 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
15 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
16 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
17 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
18 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
19 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
20 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
21 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
22 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
23 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
24 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
25 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
26 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
27 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
28 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
29 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
30 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
31 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
32 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
33 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
34 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
35 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
36 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
37 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
40 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
41 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
42 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
43 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
44 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
45 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
46 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
47 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
48 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
49 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
50 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
51 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
62 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
63 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
64 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
65 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
67 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
68 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
69 2643221647 Streptomyces sp. Root369 Isolate Unclassified
70 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
71 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
72 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
73 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
74 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
75 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
76 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
77 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
78 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
79 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
80 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
81 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
82 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
83 2858868258 Micromonospora sp. MH33 Isolate Unclassified
84 2858882152 Micromonospora noduli MED15 Isolate Nodule
85 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
86 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
87 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
88 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
89 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
90 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
91 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
92 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
93 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
94 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
95 2902582711 Micromonospora sp. AP08 Isolate Unclassified
96 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
97 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
98 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
99 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
100 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
101 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
102 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
103 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
104 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
105 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
106 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
107 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
108 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
109 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
110 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
111 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.12
Metatranscriptomes 0
Isolates 31.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 2.9
Rhizoplane 1.45
Rhizosphere 64.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0301958 3300047444 Bacteria 951
2 rootL2_10196903 3300003322 Bacteria 2774
3 Ga0070670_100364511 3300005331 Bacteria 1271
4 Ga0070680_100459970 3300005336 Bacteria 1087
5 Ga0081455_10033662 3300005937 Bacteria 4601
6 Ga0081455_10572956 3300005937 Bacteria 742
7 Ga0075364_10029773 3300006051 Bacteria 3502
8 Ga0105243_11261092 3300009148 Bacteria 755
9 Ga0207426_1014677 3300025302 Bacteria 2863
10 Ga0207650_10649664 3300025925 Bacteria 889
11 Ga0209371_1021198 3300027312 Bacteria 1581
12 Ga0307515_10266715 3300028794 Bacteria 1440
13 Ga0268256_1021227 3300030500 Bacteria 1733
14 Ga0307512_10016930 3300030522 Bacteria 6713
15 Ga0307514_10042667 3300031649 Bacteria 3566
16 Ga0307414_10816927 3300032004 Bacteria 851
17 Ga0307415_100017988 3300032126 Bacteria 4254
18 Ga0395901_0547855 3300038443 Bacteria 1173
19 Ga0439436_0027060 3300041404 Bacteria 1679
20 Ga0451789_1100490 3300041443 Bacteria 801
21 Ga0451804_1066621 3300041463 Bacteria 630
22 Ga0451845_0398056 3300041501 Bacteria 1428
23 Ga0451847_0038549 3300041503 Bacteria 912
24 Ga0451843_0338473 3300041509 Bacteria 1407
25 Ga0451843_1410600 3300041509 Bacteria 582
26 Ga0451853_0010924 3300041512 Bacteria 5303
27 Ga0451853_1551392 3300041512 Bacteria 988
28 Ga0451853_1720727 3300041512 Bacteria 6245
29 Ga0451853_2183401 3300041512 Bacteria 650
30 Ga0451853_2921090 3300041512 Bacteria 4749
31 Ga0439433_0029765 3300041999 Bacteria 1247
32 Ga0439449_0033122 3300042007 Bacteria 1926
33 Ga0439450_060228 3300042008 Bacteria 916
34 Ga0439450_158394 3300042008 Bacteria 596
35 Ga0439455_0024180 3300042012 Bacteria 1468
36 Ga0439457_001367 3300042014 Bacteria 7339
37 Ga0439462_0056933 3300042015 Bacteria 1055
38 Ga0450894_000012 3300042131 Bacteria 25903
39 Ga0450898_002564 3300042134 Bacteria 2543
40 Ga0450898_015139 3300042134 Bacteria 1304
41 Ga0450899_000280 3300042135 Bacteria 5553
42 Ga0450903_002411 3300042138 Bacteria 3333
43 Ga0450906_000893 3300042145 Bacteria 6527
44 Ga0439458_0001925 3300042157 Bacteria 5143
45 Ga0439458_0015115 3300042157 Bacteria 1746
46 Ga0466972_0162132 3300044658 Bacteria 1050
47 Ga0466964_0049467 3300044706 Bacteria 1721
48 Ga0466967_0008254 3300045976 Bacteria 7606
49 Ga0495606_0002014 3300046507 Bacteria 24940
50 Ga0495668_0000537 3300046616 Bacteria 47191
51 Ga0495625_0014763 3300046660 Bacteria 6216
52 Ga0495613_0149370 3300046689 Bacteria 1667
53 Ga0495649_0055382 3300046694 Bacteria 2143
54 Ga0495675_0598433 3300047444 Bacteria 625
55 Ga0495685_023235 3300047447 Bacteria 2134
56 Ga0495685_096179 3300047447 Bacteria 979
57 Ga0495685_199915 3300047447 Bacteria 641
58 Ga0495686_0139209 3300047472 Bacteria 1433
59 Ga0495626_0000137 3300048091 Bacteria 92873
60 Ga0495626_0027982 3300048091 Bacteria 2736
61 Ga0496119_0021473 3300048922 Bacteria 4667
62 Ga0496122_0221877 3300048925 Bacteria 1084
63 Ga0496124_0109231 3300048927 Bacteria 2229
64 Ga0501031_0223372 3300049568 Bacteria 1226
65 Ga0501032_0015523 3300049569 Bacteria 5371
66 Ga0501032_0017459 3300049569 Bacteria 5040
67 Ga0501033_0061768 3300049570 Bacteria 2760
68 Ga0501033_0115836 3300049570 Bacteria 1947
69 Ga0501034_0008522 3300049571 Bacteria 10821
70 Ga0501034_0153564 3300049571 Bacteria 2277
71 Ga0501034_0225439 3300049571 Bacteria 1825
72 Ga0501036_0018037 3300049572 Bacteria 5908
73 Ga0501036_0051535 3300049572 Bacteria 3485
74 Ga0501037_0166552 3300049573 Bacteria 1569
75 Ga0501037_0228294 3300049573 Bacteria 1307
76 Ga0501038_0008867 3300049574 Bacteria 9230
77 Ga0501038_0009643 3300049574 Bacteria 8857
78 Ga0501038_0091409 3300049574 Bacteria 2550
79 Ga0501039_0050474 3300049575 Bacteria 3219
80 Ga0501043_0007345 3300049579 Bacteria 8744
81 Ga0501043_0134847 3300049579 Bacteria 1934
82 Ga0501047_0047059 3300049581 Bacteria 4168
83 Ga0501067_0380776 3300049583 Bacteria 787
84 Ga0501070_0003505 3300049586 Bacteria 13581
85 Ga0501070_0226589 3300049586 Bacteria 1532
86 Ga0501073_0564969 3300049589 Bacteria 786
87 Ga0501080_0431011 3300049742 Bacteria 1184
88 Ga0501035_0002944 3300049822 Bacteria 16384
89 Ga0501035_0046636 3300049822 Bacteria 3897
90 Ga0501035_0328816 3300049822 Bacteria 1283
91 Ga0501044_0005501 3300049823 Bacteria 14070
92 Ga0501044_0039640 3300049823 Bacteria 4913
93 Ga0501044_0300458 3300049823 Bacteria 1534
94 nmdc:mga00v17_132140_c1 3300050491 Bacteria 1596
95 2585315014 2582581314 Bacteria 11452267
96 2644262286 2643221647 Bacteria 10741251
97 2644442911 2643221678 Bacteria 9540101
98 2772643953 2772190715 Bacteria 6959372
99 2784589443 2784132148 Bacteria 8627943
100 2785343413 2784746763 Bacteria 9783172
101 2785369512 2784746768 Bacteria 10036182
102 2786670617 2786546132 Bacteria 10419719
103 2808842666 2808606359 Bacteria 9866990
104 2819695231 2818991463 Bacteria 7948711
105 2819745711 2818991472 Bacteria 10089953
106 2855672680 2855670206 Bacteria 7120389
107 2855678057 2855676851 Bacteria 7063653
108 2857291372 2857288857 Bacteria 7189066
109 2858849004 2858848962 Bacteria 6963058
110 2858875343 2858868258 Bacteria 7683772
111 2858886482 2858882152 Bacteria 7230291
112 2858893942 2858888857 Bacteria 7060307
113 2858902351 2858895516 Bacteria 7378898
114 2862294815 2862290372 Bacteria 7471434
115 2863404709 2863404153 Bacteria 9672205
116 2867316936 2867312974 Bacteria 7058875
117 2867325315 2867319477 Bacteria 7069771
118 2869051259 2869048445 Bacteria 6875584
119 2869066566 2869061728 Bacteria 7112407
120 2880496313 2880495981 Bacteria 7340502
121 2887479899 2887478801 Bacteria 8972725
122 2902585347 2902582711 Bacteria 6187705
123 2912720847 2912715099 Bacteria 9460473
124 2919474673 2919468124 Bacteria 9133025
125 2929232085 2929226422 Bacteria 7248583
126 2947230434 2947224130 Bacteria 9938529
127 2954386227 2954380949 Bacteria 10050426
128 2954676938 2954673503 Bacteria 9685905
129 2954687220 2954682443 Bacteria 9862841
130 2954696865 2954691527 Bacteria 10720516
131 2954705271 2954701450 Bacteria 10834262
132 2995464163 2995463766 Bacteria 8577691
133 3006500391 3006493962 Bacteria 8825450
134 8003875730 8003870546 Bacteria 7396674
135 8054705369 8054704163 Bacteria 7247792
136 8054729695 8054727385 Bacteria 7558670
137 8055070419 8055066027 Bacteria 9479577
138 8056213853 8056207758 Bacteria 8639239
139 Ga0495675_0301958
140 rootL2_10196903
141 Ga0070670_100364511
142 Ga0070680_100459970
143 Ga0081455_10033662
144 Ga0081455_10572956
145 Ga0075364_10029773
146 Ga0105243_11261092
147 Ga0207426_1014677
148 Ga0207650_10649664
149 Ga0209371_1021198
150 Ga0307515_10266715
151 Ga0268256_1021227
152 Ga0307512_10016930
153 Ga0307514_10042667
154 Ga0307414_10816927
155 Ga0307415_100017988
156 Ga0395901_0547855
157 Ga0439436_0027060
158 Ga0451789_1100490
159 Ga0451804_1066621
160 Ga0451845_0398056
161 Ga0451847_0038549
162 Ga0451843_0338473
163 Ga0451843_1410600
164 Ga0451853_0010924
165 Ga0451853_1551392
166 Ga0451853_1720727
167 Ga0451853_2183401
168 Ga0451853_2921090
169 Ga0439433_0029765
170 Ga0439449_0033122
171 Ga0439450_060228
172 Ga0439450_158394
173 Ga0439455_0024180
174 Ga0439457_001367
175 Ga0439462_0056933
176 Ga0450894_000012
177 Ga0450898_002564
178 Ga0450898_015139
179 Ga0450899_000280
180 Ga0450903_002411
181 Ga0450906_000893
182 Ga0439458_0001925
183 Ga0439458_0015115
184 Ga0466972_0162132
185 Ga0466964_0049467
186 Ga0466967_0008254
187 Ga0495606_0002014
188 Ga0495668_0000537
189 Ga0495625_0014763
190 Ga0495613_0149370
191 Ga0495649_0055382
192 Ga0495675_0598433
193 Ga0495685_023235
194 Ga0495685_096179
195 Ga0495685_199915
196 Ga0495686_0139209
197 Ga0495626_0000137
198 Ga0495626_0027982
199 Ga0496119_0021473
200 Ga0496122_0221877
201 Ga0496124_0109231
202 Ga0501031_0223372
203 Ga0501032_0015523
204 Ga0501032_0017459
205 Ga0501033_0061768
206 Ga0501033_0115836
207 Ga0501034_0008522
208 Ga0501034_0153564
209 Ga0501034_0225439
210 Ga0501036_0018037
211 Ga0501036_0051535
212 Ga0501037_0166552
213 Ga0501037_0228294
214 Ga0501038_0008867
215 Ga0501038_0009643
216 Ga0501038_0091409
217 Ga0501039_0050474
218 Ga0501043_0007345
219 Ga0501043_0134847
220 Ga0501047_0047059
221 Ga0501067_0380776
222 Ga0501070_0003505
223 Ga0501070_0226589
224 Ga0501073_0564969
225 Ga0501080_0431011
226 Ga0501035_0002944
227 Ga0501035_0046636
228 Ga0501035_0328816
229 Ga0501044_0005501
230 Ga0501044_0039640
231 Ga0501044_0300458
232 nmdc:mga00v17_132140_c1
233 2585315014
234 2644262286
235 2644442911
236 2772643953
237 2784589443
238 2785343413
239 2785369512
240 2786670617
241 2808842666
242 2819695231
243 2819745711
244 2855672680
245 2855678057
246 2857291372
247 2858849004
248 2858875343
249 2858886482
250 2858893942
251 2858902351
252 2862294815
253 2863404709
254 2867316936
255 2867325315
256 2869051259
257 2869066566
258 2880496313
259 2887479899
260 2902585347
261 2912720847
262 2919474673
263 2929232085
264 2947230434
265 2954386227
266 2954676938
267 2954687220
268 2954696865
269 2954705271
270 2995464163
271 3006500391
272 8003875730
273 8054705369
274 8054729695
275 8055070419
276 8056213853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

76

165

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

32

155

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

76

157

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8796 53 146
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8761 53 146
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8695 53 144
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8355 53 146
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8351 53 142
ID Description Score Start End Superfamily
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8986 53 135 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8781 53 147 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8726 59 133 3.40.630.30
af_K7VFD8_74_198_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8635 59 147 3.40.630.30
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8634 53 146 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4R4YWD1-F1-model_v4 N-acetyltransferase 0.9993 1 146 GO:0016747
AF-A0A6G4XG78-F1-model_v4 GNAT family N-acetyltransferase 0.9991 4 145 GO:0016747
AF-I0L293-F1-model_v4 Acyl-CoA N-acyltransferase 0.999 1 147 GO:0016747
AF-A0A7C9J204-F1-model_v4 GNAT family N-acetyltransferase 0.999 7 146 GO:0016747
AF-A0A4R2HMQ4-F1-model_v4 N-acetylglutamate synthase-like GNAT family acetyltransferase 0.9987 1 146 GO:0016747

Map