F173839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 138 | 33 | 276 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300038725|Ga0400484_34136|Ga0400484_34136_4894_5973 |
| Length | 359 |
| Sequence | MNKHYLSSLLAVFALALIAYVGASVGPLQWLFGVFIPYLAVIVFIVGFVRRVMGWSKSAVPFSIPTTCGQQKSMPWIKQAKIDNPSTGVGVFIRMVLEIVTFRSLFRNTRMKIKSSGTISYNLEIFLWVGALAFHYAFLTTLVRHFRFFLEPVPWCLQMLEKVDSFFRIEILYDVIQFGLPGIYLSGVLLLAAATYLLLRRMTVSNVRYISLASDFFPLFLIMGIAFTGILMRYFTKVDIVSIKELTMGLVTLNPTIPQGISPLFFIHMFFVSILLIYFPFSKLMHMGGVFLSPTRNLKANTREYRHVNPWNYPVKVHTYDAYEDDFRQKMVDAGLPVEKMPEPQPQEPEKPAAEDKKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 2 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 3 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 4 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 5 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 6 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 7 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 8 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 9 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 10 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 11 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 18 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 19 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 20 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 21 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 22 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 23 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 24 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 25 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 26 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 27 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 28 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 29 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 30 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 31 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 32 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 33 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.68 |
| Metatranscriptomes | 11.59 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 71.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400484_34136 | 3300038725 | Bacteria | 6023 |
| 2 | Ga0316575_10019298 | 3300031665 | Bacteria | 2606 |
| 3 | Ga0316579_10001575 | 3300031691 | Bacteria | 8326 |
| 4 | Ga0316579_10014626 | 3300031691 | Bacteria | 3398 |
| 5 | Ga0316579_10021164 | 3300031691 | Bacteria | 2894 |
| 6 | Ga0316579_10033865 | 3300031691 | Bacteria | 2347 |
| 7 | Ga0316579_10053920 | 3300031691 | Unclassified | 1885 |
| 8 | Ga0265342_10067925 | 3300031712 | Bacteria | 2085 |
| 9 | Ga0316576_10000341 | 3300031727 | Bacteria | 20999 |
| 10 | Ga0316576_10001836 | 3300031727 | Bacteria | 11780 |
| 11 | Ga0316576_10043371 | 3300031727 | Bacteria | 3245 |
| 12 | Ga0316576_10056902 | 3300031727 | Bacteria | 2857 |
| 13 | Ga0316576_10061233 | 3300031727 | Bacteria | 2758 |
| 14 | Ga0316576_10159051 | 3300031727 | Bacteria | 1703 |
| 15 | Ga0316576_10165019 | 3300031727 | Bacteria | 1671 |
| 16 | Ga0316576_10187536 | 3300031727 | Unclassified | 1560 |
| 17 | Ga0316578_10009328 | 3300031728 | Bacteria | 5044 |
| 18 | Ga0316578_10009854 | 3300031728 | Bacteria | 4932 |
| 19 | Ga0316578_10011377 | 3300031728 | Bacteria | 4652 |
| 20 | Ga0316578_10011886 | 3300031728 | Bacteria | 4572 |
| 21 | Ga0316578_10026642 | 3300031728 | Bacteria | 3262 |
| 22 | Ga0316578_10040093 | 3300031728 | Bacteria | 2706 |
| 23 | Ga0316578_10040197 | 3300031728 | Bacteria | 2703 |
| 24 | Ga0316578_10040870 | 3300031728 | Bacteria | 2683 |
| 25 | Ga0316578_10136190 | 3300031728 | Unclassified | 1478 |
| 26 | Ga0316577_10001878 | 3300031733 | Bacteria | 10153 |
| 27 | Ga0316577_10013469 | 3300031733 | Bacteria | 4471 |
| 28 | Ga0316577_10034911 | 3300031733 | Bacteria | 2810 |
| 29 | Ga0316577_10084945 | 3300031733 | Bacteria | 1771 |
| 30 | Ga0316577_10121426 | 3300031733 | Bacteria | 1468 |
| 31 | Ga0316577_10125638 | 3300031733 | Bacteria | 1442 |
| 32 | Ga0316577_10190160 | 3300031733 | Bacteria | 1160 |
| 33 | Ga0316583_10001343 | 3300032133 | Bacteria | 8140 |
| 34 | Ga0316583_10001963 | 3300032133 | Bacteria | 7023 |
| 35 | Ga0316583_10013257 | 3300032133 | Bacteria | 2974 |
| 36 | Ga0316583_10018158 | 3300032133 | Bacteria | 2526 |
| 37 | Ga0316583_10020869 | 3300032133 | Bacteria | 2348 |
| 38 | Ga0316583_10045126 | 3300032133 | Bacteria | 1557 |
| 39 | Ga0316585_10009032 | 3300032137 | Bacteria | 2897 |
| 40 | Ga0316585_10015684 | 3300032137 | Bacteria | 2275 |
| 41 | Ga0316580_10007439 | 3300032139 | Bacteria | 3264 |
| 42 | Ga0316580_10030112 | 3300032139 | Bacteria | 1680 |
| 43 | Ga0316593_10005848 | 3300032168 | Bacteria | 3280 |
| 44 | Ga0316593_10013944 | 3300032168 | Bacteria | 2388 |
| 45 | Ga0316593_10016156 | 3300032168 | Bacteria | 2258 |
| 46 | Ga0316593_10028672 | 3300032168 | Bacteria | 1795 |
| 47 | Ga0316592_1005169 | 3300033524 | Bacteria | 2466 |
| 48 | Ga0316592_1012051 | 3300033524 | Unclassified | 1766 |
| 49 | Ga0316586_1001741 | 3300033527 | Bacteria | 2581 |
| 50 | Ga0316588_1003519 | 3300033528 | Bacteria | 2870 |
| 51 | Ga0316588_1007839 | 3300033528 | Bacteria | 2179 |
| 52 | Ga0316588_1023879 | 3300033528 | Bacteria | 1405 |
| 53 | Ga0316588_1031880 | 3300033528 | Bacteria | 1238 |
| 54 | Ga0316587_1012493 | 3300033529 | Bacteria | 1381 |
| 55 | Ga0316596_1003522 | 3300033541 | Bacteria | 3441 |
| 56 | Ga0316596_1007537 | 3300033541 | Bacteria | 2576 |
| 57 | Ga0316596_1022064 | 3300033541 | Bacteria | 1625 |
| 58 | Ga0316596_1027349 | 3300033541 | Bacteria | 1471 |
| 59 | Ga0316574_0029739 | 3300035398 | Bacteria | 3303 |
| 60 | Ga0316574_0030949 | 3300035398 | Bacteria | 3244 |
| 61 | Ga0316574_0071560 | 3300035398 | Bacteria | 2190 |
| 62 | Ga0316574_0129337 | 3300035398 | Bacteria | 1624 |
| 63 | Ga0316582_0005361 | 3300036647 | Bacteria | 6595 |
| 64 | Ga0316582_0009093 | 3300036647 | Bacteria | 5375 |
| 65 | Ga0316582_0011259 | 3300036647 | Bacteria | 4938 |
| 66 | Ga0316582_0027883 | 3300036647 | Unclassified | 3417 |
| 67 | Ga0316582_0029605 | 3300036647 | Bacteria | 3328 |
| 68 | Ga0316582_0049706 | 3300036647 | Bacteria | 2653 |
| 69 | Ga0316582_0091581 | 3300036647 | Bacteria | 2002 |
| 70 | Ga0316582_0105036 | 3300036647 | Bacteria | 1875 |
| 71 | Ga0316582_0198383 | 3300036647 | Bacteria | 1369 |
| 72 | Ga0316582_0286646 | 3300036647 | Bacteria | 1130 |
| 73 | Ga0316584_0000574 | 3300036712 | Bacteria | 19837 |
| 74 | Ga0316584_0000922 | 3300036712 | Bacteria | 16755 |
| 75 | Ga0316584_0001890 | 3300036712 | Bacteria | 13009 |
| 76 | Ga0316584_0005783 | 3300036712 | Bacteria | 8338 |
| 77 | Ga0316584_0021469 | 3300036712 | Bacteria | 4693 |
| 78 | Ga0316584_0023202 | 3300036712 | Bacteria | 4533 |
| 79 | Ga0316584_0029184 | 3300036712 | Bacteria | 4071 |
| 80 | Ga0316584_0035979 | 3300036712 | Bacteria | 3673 |
| 81 | Ga0316584_0037462 | 3300036712 | Bacteria | 3603 |
| 82 | Ga0316584_0104082 | 3300036712 | Bacteria | 2125 |
| 83 | Ga0316584_0112170 | 3300036712 | Bacteria | 2040 |
| 84 | Ga0316584_0154261 | 3300036712 | Bacteria | 1708 |
| 85 | Ga0316584_0167566 | 3300036712 | Unclassified | 1631 |
| 86 | Ga0316584_0199049 | 3300036712 | Bacteria | 1479 |
| 87 | Ga0316581_0001402 | 3300037588 | Bacteria | 5393 |
| 88 | Ga0316581_0004229 | 3300037588 | Bacteria | 3646 |
| 89 | Ga0400484_36938 | 3300038725 | Unclassified | 2173 |
| 90 | Ga0400484_37010 | 3300038725 | Bacteria | 12641 |
| 91 | Ga0400490_09006 | 3300038726 | Bacteria | 131367 |
| 92 | Ga0400490_22447 | 3300038726 | Bacteria | 76643 |
| 93 | Ga0400490_26661 | 3300038726 | Bacteria | 1938 |
| 94 | Ga0400490_41346 | 3300038726 | Bacteria | 3795 |
| 95 | Ga0400490_49837 | 3300038726 | Unclassified | 2575 |
| 96 | Ga0400490_51393 | 3300038726 | Bacteria | 2025 |
| 97 | Ga0400491_16087 | 3300038727 | Bacteria | 2497 |
| 98 | Ga0400491_29399 | 3300038727 | Bacteria | 2287 |
| 99 | Ga0400491_29678 | 3300038727 | Bacteria | 1186 |
| 100 | Ga0400485_04718 | 3300038735 | Bacteria | 4208 |
| 101 | Ga0400485_07850 | 3300038735 | Bacteria | 2887 |
| 102 | Ga0400485_12144 | 3300038735 | Bacteria | 7226 |
| 103 | Ga0400485_21715 | 3300038735 | Bacteria | 56903 |
| 104 | Ga0400488_05897 | 3300038741 | Bacteria | 10179 |
| 105 | Ga0400488_17897 | 3300038741 | Bacteria | 1349 |
| 106 | Ga0400488_23193 | 3300038741 | Bacteria | 22752 |
| 107 | Ga0400488_35543 | 3300038741 | Bacteria | 4078 |
| 108 | Ga0400486_06603 | 3300038742 | Bacteria | 21373 |
| 109 | Ga0400486_12355 | 3300038742 | Bacteria | 46945 |
| 110 | Ga0400486_18734 | 3300038742 | Bacteria | 45001 |
| 111 | Ga0400486_30854 | 3300038742 | Bacteria | 55977 |
| 112 | Ga0400483_029519 | 3300039062 | Bacteria | 3132 |
| 113 | Ga0400483_068767 | 3300039062 | Bacteria | 84641 |
| 114 | Ga0400483_107517 | 3300039062 | Bacteria | 9669 |
| 115 | Ga0400483_154168 | 3300039062 | Bacteria | 5586 |
| 116 | Ga0400483_254784 | 3300039062 | Bacteria | 1076 |
| 117 | Ga0400483_272039 | 3300039062 | Bacteria | 3001 |
| 118 | Ga0400489_00934 | 3300039093 | Bacteria | 47174 |
| 119 | Ga0400489_13182 | 3300039093 | Bacteria | 6669 |
| 120 | Ga0400489_31218 | 3300039093 | Bacteria | 19509 |
| 121 | Ga0400489_31986 | 3300039093 | Bacteria | 16663 |
| 122 | Ga0400489_39138 | 3300039093 | Bacteria | 21530 |
| 123 | Ga0400487_16151 | 3300039110 | Bacteria | 7044 |
| 124 | Ga0400487_34922 | 3300039110 | Bacteria | 34543 |
| 125 | Ga0400487_34999 | 3300039110 | Bacteria | 1680 |
| 126 | Ga0400487_65646 | 3300039110 | Bacteria | 3011 |
| 127 | Ga0451577_0000353 | 3300042876 | Bacteria | 85621 |
| 128 | Ga0451577_0001701 | 3300042876 | Bacteria | 28375 |
| 129 | Ga0453683_0071445 | 3300044673 | Bacteria | 2172 |
| 130 | Ga0453684_0000498 | 3300044712 | Bacteria | 153608 |
| 131 | Ga0453684_0001092 | 3300044712 | Bacteria | 85621 |
| 132 | Ga0453684_0001450 | 3300044712 | Bacteria | 67391 |
| 133 | Ga0453684_0002534 | 3300044712 | Bacteria | 44015 |
| 134 | Ga0453684_0031017 | 3300044712 | Bacteria | 7530 |
| 135 | Ga0453684_0092068 | 3300044712 | Bacteria | 3739 |
| 136 | Ga0453684_0174953 | 3300044712 | Bacteria | 2526 |
| 137 | Ga0451576_0026672 | 3300045051 | Bacteria | 6212 |
| 138 | 2740992770 | 2740891818 | Bacteria | 6711283 |
| 139 | Ga0400484_34136 | |||
| 140 | Ga0316575_10019298 | |||
| 141 | Ga0316579_10001575 | |||
| 142 | Ga0316579_10014626 | |||
| 143 | Ga0316579_10021164 | |||
| 144 | Ga0316579_10033865 | |||
| 145 | Ga0316579_10053920 | |||
| 146 | Ga0265342_10067925 | |||
| 147 | Ga0316576_10000341 | |||
| 148 | Ga0316576_10001836 | |||
| 149 | Ga0316576_10043371 | |||
| 150 | Ga0316576_10056902 | |||
| 151 | Ga0316576_10061233 | |||
| 152 | Ga0316576_10159051 | |||
| 153 | Ga0316576_10165019 | |||
| 154 | Ga0316576_10187536 | |||
| 155 | Ga0316578_10009328 | |||
| 156 | Ga0316578_10009854 | |||
| 157 | Ga0316578_10011377 | |||
| 158 | Ga0316578_10011886 | |||
| 159 | Ga0316578_10026642 | |||
| 160 | Ga0316578_10040093 | |||
| 161 | Ga0316578_10040197 | |||
| 162 | Ga0316578_10040870 | |||
| 163 | Ga0316578_10136190 | |||
| 164 | Ga0316577_10001878 | |||
| 165 | Ga0316577_10013469 | |||
| 166 | Ga0316577_10034911 | |||
| 167 | Ga0316577_10084945 | |||
| 168 | Ga0316577_10121426 | |||
| 169 | Ga0316577_10125638 | |||
| 170 | Ga0316577_10190160 | |||
| 171 | Ga0316583_10001343 | |||
| 172 | Ga0316583_10001963 | |||
| 173 | Ga0316583_10013257 | |||
| 174 | Ga0316583_10018158 | |||
| 175 | Ga0316583_10020869 | |||
| 176 | Ga0316583_10045126 | |||
| 177 | Ga0316585_10009032 | |||
| 178 | Ga0316585_10015684 | |||
| 179 | Ga0316580_10007439 | |||
| 180 | Ga0316580_10030112 | |||
| 181 | Ga0316593_10005848 | |||
| 182 | Ga0316593_10013944 | |||
| 183 | Ga0316593_10016156 | |||
| 184 | Ga0316593_10028672 | |||
| 185 | Ga0316592_1005169 | |||
| 186 | Ga0316592_1012051 | |||
| 187 | Ga0316586_1001741 | |||
| 188 | Ga0316588_1003519 | |||
| 189 | Ga0316588_1007839 | |||
| 190 | Ga0316588_1023879 | |||
| 191 | Ga0316588_1031880 | |||
| 192 | Ga0316587_1012493 | |||
| 193 | Ga0316596_1003522 | |||
| 194 | Ga0316596_1007537 | |||
| 195 | Ga0316596_1022064 | |||
| 196 | Ga0316596_1027349 | |||
| 197 | Ga0316574_0029739 | |||
| 198 | Ga0316574_0030949 | |||
| 199 | Ga0316574_0071560 | |||
| 200 | Ga0316574_0129337 | |||
| 201 | Ga0316582_0005361 | |||
| 202 | Ga0316582_0009093 | |||
| 203 | Ga0316582_0011259 | |||
| 204 | Ga0316582_0027883 | |||
| 205 | Ga0316582_0029605 | |||
| 206 | Ga0316582_0049706 | |||
| 207 | Ga0316582_0091581 | |||
| 208 | Ga0316582_0105036 | |||
| 209 | Ga0316582_0198383 | |||
| 210 | Ga0316582_0286646 | |||
| 211 | Ga0316584_0000574 | |||
| 212 | Ga0316584_0000922 | |||
| 213 | Ga0316584_0001890 | |||
| 214 | Ga0316584_0005783 | |||
| 215 | Ga0316584_0021469 | |||
| 216 | Ga0316584_0023202 | |||
| 217 | Ga0316584_0029184 | |||
| 218 | Ga0316584_0035979 | |||
| 219 | Ga0316584_0037462 | |||
| 220 | Ga0316584_0104082 | |||
| 221 | Ga0316584_0112170 | |||
| 222 | Ga0316584_0154261 | |||
| 223 | Ga0316584_0167566 | |||
| 224 | Ga0316584_0199049 | |||
| 225 | Ga0316581_0001402 | |||
| 226 | Ga0316581_0004229 | |||
| 227 | Ga0400484_36938 | |||
| 228 | Ga0400484_37010 | |||
| 229 | Ga0400490_09006 | |||
| 230 | Ga0400490_22447 | |||
| 231 | Ga0400490_26661 | |||
| 232 | Ga0400490_41346 | |||
| 233 | Ga0400490_49837 | |||
| 234 | Ga0400490_51393 | |||
| 235 | Ga0400491_16087 | |||
| 236 | Ga0400491_29399 | |||
| 237 | Ga0400491_29678 | |||
| 238 | Ga0400485_04718 | |||
| 239 | Ga0400485_07850 | |||
| 240 | Ga0400485_12144 | |||
| 241 | Ga0400485_21715 | |||
| 242 | Ga0400488_05897 | |||
| 243 | Ga0400488_17897 | |||
| 244 | Ga0400488_23193 | |||
| 245 | Ga0400488_35543 | |||
| 246 | Ga0400486_06603 | |||
| 247 | Ga0400486_12355 | |||
| 248 | Ga0400486_18734 | |||
| 249 | Ga0400486_30854 | |||
| 250 | Ga0400483_029519 | |||
| 251 | Ga0400483_068767 | |||
| 252 | Ga0400483_107517 | |||
| 253 | Ga0400483_154168 | |||
| 254 | Ga0400483_254784 | |||
| 255 | Ga0400483_272039 | |||
| 256 | Ga0400489_00934 | |||
| 257 | Ga0400489_13182 | |||
| 258 | Ga0400489_31218 | |||
| 259 | Ga0400489_31986 | |||
| 260 | Ga0400489_39138 | |||
| 261 | Ga0400487_16151 | |||
| 262 | Ga0400487_34922 | |||
| 263 | Ga0400487_34999 | |||
| 264 | Ga0400487_65646 | |||
| 265 | Ga0451577_0000353 | |||
| 266 | Ga0451577_0001701 | |||
| 267 | Ga0453683_0071445 | |||
| 268 | Ga0453684_0000498 | |||
| 269 | Ga0453684_0001092 | |||
| 270 | Ga0453684_0001450 | |||
| 271 | Ga0453684_0002534 | |||
| 272 | Ga0453684_0031017 | |||
| 273 | Ga0453684_0092068 | |||
| 274 | Ga0453684_0174953 | |||
| 275 | Ga0451576_0026672 | |||
| 276 | 2740992770 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y5i-assembly1.cif.gz_C | the crystal structure of the narghi mutant nari-k86a | 0.7357 | 29 | 293 |
| 1y4z-assembly1.cif.gz_C | the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol | 0.726 | 29 | 293 |
| 3ir5-assembly1.cif.gz_C | crystal structure of narghi mutant narg-h49c | 0.7144 | 29 | 293 |
| 1siw-assembly1.cif.gz_C | crystal structure of the apomolybdo-narghi | 0.7116 | 29 | 293 |
| 3ir6-assembly1.cif.gz_C | crystal structure of narghi mutant narg-h49s | 0.7047 | 29 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVM4_1_215_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7171 | 31 | 293 | 1.20.950.20 |
| 1siwC01 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7125 | 30 | 293 | 1.20.950.20 |
| af_Q2FVM4_1_215_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6894 | 31 | 293 | 1.20.950.20 |
| 1siwC01 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6846 | 30 | 293 | 1.20.950.20 |
| af_O33268_1_267_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.5649 | 28 | 297 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1AIA4-F1-model_v4 | Nitrate reductase gamma subunit (EC 1.7.99.4) | 0.9484 | 137 | 278 |
GO:0005886
GO:0016491 |
| AF-A0A847UY48-F1-model_v4 | Sulfate reduction electron transfer complex DsrMKJOP subunit DsrM | 0.9081 | 10 | 301 |
GO:0005886
GO:0016491 |
| AF-A0A3A4SEW1-F1-model_v4 | Menaquinol oxidoreductase | 0.9052 | 8 | 276 |
GO:0005886
GO:0016491 |
| AF-A0A660ZAY1-F1-model_v4 | Menaquinol oxidoreductase | 0.9037 | 7 | 259 |
GO:0005886
GO:0016491 |
| AF-A0A1F3X1Y8-F1-model_v4 | Nitrate reductase | 0.9003 | 31 | 303 |
GO:0005886
GO:0016491 |