F173548

General Info

Members Datasets Scaffolds Average Seq Length
138 112 276 192

Family's Representative Sequence

Representative Sequence 3300030745|Ga0316182_1036667|Ga0316182_10366672
Length 205
Sequence MSNNNSDDIGSGGVLRPAIVLFVLLGALTGLVYPLAVTGTARALFPSQAAGSLVVVDGRAVGSALIGQNFVDPKHFWGRPSATAPQPYDARASGGSNLGPLNPALVDAVRARVAALRAADPGNAAPVPVDLVTSSASGLDPHISPAAAHYQAARVARVRGLPLAQVEALIARHTEAPLGGLLGEPRVNVLALNLALDGVPPPPAR

Samples

Sample ID Description Type Environment
1 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
84 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
92 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
100 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
103 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
104 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
105 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
106 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
107 2643221660 Methylibium sp. Root1272 Isolate Unclassified
108 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
109 2904456579 Variovorax sp. 2002 Isolate Unclassified
110 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
111 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
112 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 1.45
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.54
Nodule 0
Rhizoplane 2.17
Rhizosphere 52.17
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316182_1036667 3300030745 Bacteria 1816
2 Ga0006562J51391_1112376 3300003578 Bacteria 2022
3 Ga0006562J51391_1112377 3300003578 Bacteria 970
4 Ga0055537_1000512 3300003773 Bacteria 23014
5 Ga0055534_1000234 3300003784 Bacteria 39867
6 Ga0055528_1007094 3300003790 Bacteria 5003
7 Ga0068869_100536738 3300005334 Bacteria 981
8 Ga0070680_100042050 3300005336 Bacteria 3707
9 Ga0068868_100290879 3300005338 Bacteria 1385
10 Ga0070669_100009158 3300005353 Bacteria 7056
11 Ga0070714_100005890 3300005435 Bacteria 9406
12 Ga0070701_10288067 3300005438 Bacteria 1005
13 Ga0070681_10024861 3300005458 Bacteria 6026
14 Ga0070679_100007983 3300005530 Bacteria 9933
15 Ga0070665_100055705 3300005548 Bacteria 3965
16 Ga0070665_100086187 3300005548 Bacteria 3146
17 Ga0068857_100132483 3300005577 Bacteria 2249
18 Ga0068854_100059500 3300005578 Bacteria 2761
19 Ga0068861_100060272 3300005719 Bacteria 2908
20 Ga0068863_101065827 3300005841 Bacteria 812
21 Ga0068860_100057242 3300005843 Bacteria 3706
22 Ga0068860_101303760 3300005843 Bacteria 747
23 Ga0075365_10221214 3300006038 Bacteria 1328
24 Ga0075363_100048421 3300006048 Bacteria 2260
25 Ga0075363_100108654 3300006048 Bacteria 1540
26 Ga0075363_100312988 3300006048 Bacteria 913
27 Ga0075363_100386160 3300006048 Bacteria 821
28 Ga0075364_10007068 3300006051 Bacteria 6636
29 Ga0075432_10133153 3300006058 Bacteria 943
30 Ga0075362_10026527 3300006177 Bacteria 2475
31 Ga0075362_10026557 3300006177 Bacteria 2474
32 Ga0075367_10346991 3300006178 Bacteria 937
33 Ga0075366_10110164 3300006195 Bacteria 1656
34 Ga0075366_10186747 3300006195 Bacteria 1259
35 Ga0075366_10228241 3300006195 Bacteria 1134
36 Ga0075370_10000508 3300006353 Bacteria 14806
37 Ga0075370_10044943 3300006353 Bacteria 2497
38 Ga0075370_10173286 3300006353 Bacteria 1269
39 Ga0075370_10220722 3300006353 Bacteria 1120
40 Ga0075370_10263780 3300006353 Bacteria 1022
41 Ga0105240_10001114 3300009093 Bacteria 47310
42 Ga0105243_10085910 3300009148 Bacteria 2579
43 Ga0105243_10523449 3300009148 Bacteria 1128
44 Ga0105238_10002696 3300009551 Bacteria 17661
45 Ga0105249_10764116 3300009553 Bacteria 1029
46 Ga0105239_10042364 3300010375 Bacteria 4989
47 Ga0157370_10002969 3300013104 Bacteria 20167
48 Ga0157369_10008067 3300013105 Bacteria 12073
49 Ga0157375_10129628 3300013308 Bacteria 2640
50 Ga0163163_10510394 3300014325 Bacteria 1264
51 Ga0157379_10007341 3300014968 Bacteria 9538
52 Ga0182006_1051149 3300015261 Bacteria 1590
53 Ga0182006_1136337 3300015261 Bacteria 841
54 Ga0163161_10000142 3300017792 Bacteria 66331
55 Ga0209565_1000356 3300025263 Bacteria 39995
56 Ga0209673_1000842 3300025273 Bacteria 39995
57 Ga0209673_1015035 3300025273 Bacteria 2961
58 Ga0209675_1000163 3300025291 Bacteria 81884
59 Ga0209676_1015226 3300025292 Bacteria 2841
60 Ga0209051_1078694 3300025303 Bacteria 960
61 Ga0207707_10000307 3300025912 Bacteria 51390
62 Ga0207695_10021507 3300025913 Bacteria 7358
63 Ga0207660_10043602 3300025917 Bacteria 3152
64 Ga0207681_10002577 3300025923 Bacteria 11492
65 Ga0207694_10009288 3300025924 Bacteria 7421
66 Ga0207650_11001556 3300025925 Bacteria 711
67 Ga0207664_10012694 3300025929 Bacteria 6029
68 Ga0207709_10159210 3300025935 Bacteria 1573
69 Ga0207689_10862708 3300025942 Bacteria 764
70 Ga0207667_10008589 3300025949 Bacteria 12123
71 Ga0207640_10032743 3300025981 Bacteria 3225
72 Ga0207703_10261606 3300026035 Bacteria 1564
73 Ga0207702_10964401 3300026078 Bacteria 846
74 Ga0207648_10347139 3300026089 Bacteria 1337
75 Ga0207674_10301685 3300026116 Bacteria 1551
76 Ga0207675_100002292 3300026118 Bacteria 19003
77 Ga0268266_10020376 3300028379 Bacteria 5652
78 Ga0268266_10649144 3300028379 Unclassified 1015
79 Ga0268264_11367384 3300028381 Bacteria 718
80 Ga0265318_10153155 3300028577 Bacteria 845
81 Ga0307515_10000664 3300028794 Bacteria 79458
82 Ga0307515_10002453 3300028794 Bacteria 40400
83 Ga0307515_10333725 3300028794 Bacteria 1173
84 Ga0307512_10033080 3300030522 Bacteria 4454
85 Ga0307512_10155698 3300030522 Bacteria 1353
86 Ga0307512_10239486 3300030522 Bacteria 920
87 Ga0265331_10007721 3300031250 Bacteria 6186
88 Ga0265327_10000229 3300031251 Bacteria 113907
89 Ga0265327_10000722 3300031251 Bacteria 51801
90 Ga0307513_10005218 3300031456 Bacteria 17209
91 Ga0307513_10161285 3300031456 Bacteria 2135
92 Ga0307509_10163939 3300031507 Bacteria 2115
93 Ga0307408_100308579 3300031548 Bacteria 1328
94 Ga0307508_10000123 3300031616 Bacteria 92439
95 Ga0307514_10000530 3300031649 Bacteria 74660
96 Ga0307514_10011156 3300031649 Bacteria 7480
97 Ga0307516_10003862 3300031730 Bacteria 18937
98 Ga0307411_11126363 3300032005 Bacteria 708
99 Ga0373937_0900095 3300036401 Bacteria 834
100 Ga0373925_0339322 3300037068 Bacteria 1219
101 Ga0451802_0444555 3300041460 Bacteria 1483
102 Ga0451807_2702610 3300041486 Bacteria 776
103 Ga0451853_0466856 3300041512 Bacteria 1029
104 Ga0451576_0105467 3300045051 Bacteria 2932
105 Ga0495629_0650763 3300046459 Bacteria 702
106 Ga0495650_0012739 3300046471 Bacteria 4505
107 Ga0495597_0018214 3300046542 Bacteria 3298
108 Ga0495671_0276991 3300046692 Bacteria 808
109 Ga0495581_0199085 3300047315 Bacteria 1172
110 Ga0495672_0000014 3300047320 Bacteria 505636
111 Ga0496110_0054661 3300048913 Bacteria 3512
112 Ga0496116_0270634 3300048919 Bacteria 830
113 Ga0496121_0029241 3300048924 Bacteria 5103
114 Ga0496124_0163490 3300048927 Bacteria 1732
115 nmdc:mga03683_31284_c1 3300050489 Bacteria 2134
116 nmdc:mga00v17_4332_c1 3300050491 Bacteria 1610
117 nmdc:mga0yw44_22051_c1 3300050492 Bacteria 3564
118 nmdc:mga0k408_40621_c1 3300050493 Bacteria 2678
119 nmdc:mga0k408_56931_c1 3300050493 Bacteria 2269
120 nmdc:mga06z11_451083_c1 3300050494 Bacteria 777
121 nmdc:mga07m45_25419_c1 3300050496 Bacteria 3247
122 nmdc:mga07m45_52236_c1 3300050496 Bacteria 2307
123 nmdc:mga09592_470875_c1 3300050508 Bacteria 1083
124 nmdc:mga0n895_489944_c1 3300050512 Bacteria 1239
125 Ga0500651_0037545 3300053093 Bacteria 3053
126 Ga0500593_000696 3300053117 Bacteria 12801
127 Ga0500616_0000030 3300053153 Bacteria 415224
128 Ga0500645_048221 3300053730 Bacteria 1248
129 2643968221 2643221592 Bacteria 6608788
130 2644143626 2643221625 Bacteria 6512927
131 2644161580 2643221628 Bacteria 5745828
132 2644271999 2643221648 Bacteria 6521465
133 2644341379 2643221660 Bacteria 4208257
134 2904451004 2904449895 Bacteria 6927402
135 2904457860 2904456579 Bacteria 6819253
136 2945951066 2945945610 Bacteria 5951079
137 2945974273 2945972063 Bacteria 6086495
138 2954769531 2954767861 Bacteria 5535784
139 Ga0316182_1036667
140 Ga0006562J51391_1112376
141 Ga0006562J51391_1112377
142 Ga0055537_1000512
143 Ga0055534_1000234
144 Ga0055528_1007094
145 Ga0068869_100536738
146 Ga0070680_100042050
147 Ga0068868_100290879
148 Ga0070669_100009158
149 Ga0070714_100005890
150 Ga0070701_10288067
151 Ga0070681_10024861
152 Ga0070679_100007983
153 Ga0070665_100055705
154 Ga0070665_100086187
155 Ga0068857_100132483
156 Ga0068854_100059500
157 Ga0068861_100060272
158 Ga0068863_101065827
159 Ga0068860_100057242
160 Ga0068860_101303760
161 Ga0075365_10221214
162 Ga0075363_100048421
163 Ga0075363_100108654
164 Ga0075363_100312988
165 Ga0075363_100386160
166 Ga0075364_10007068
167 Ga0075432_10133153
168 Ga0075362_10026527
169 Ga0075362_10026557
170 Ga0075367_10346991
171 Ga0075366_10110164
172 Ga0075366_10186747
173 Ga0075366_10228241
174 Ga0075370_10000508
175 Ga0075370_10044943
176 Ga0075370_10173286
177 Ga0075370_10220722
178 Ga0075370_10263780
179 Ga0105240_10001114
180 Ga0105243_10085910
181 Ga0105243_10523449
182 Ga0105238_10002696
183 Ga0105249_10764116
184 Ga0105239_10042364
185 Ga0157370_10002969
186 Ga0157369_10008067
187 Ga0157375_10129628
188 Ga0163163_10510394
189 Ga0157379_10007341
190 Ga0182006_1051149
191 Ga0182006_1136337
192 Ga0163161_10000142
193 Ga0209565_1000356
194 Ga0209673_1000842
195 Ga0209673_1015035
196 Ga0209675_1000163
197 Ga0209676_1015226
198 Ga0209051_1078694
199 Ga0207707_10000307
200 Ga0207695_10021507
201 Ga0207660_10043602
202 Ga0207681_10002577
203 Ga0207694_10009288
204 Ga0207650_11001556
205 Ga0207664_10012694
206 Ga0207709_10159210
207 Ga0207689_10862708
208 Ga0207667_10008589
209 Ga0207640_10032743
210 Ga0207703_10261606
211 Ga0207702_10964401
212 Ga0207648_10347139
213 Ga0207674_10301685
214 Ga0207675_100002292
215 Ga0268266_10020376
216 Ga0268266_10649144
217 Ga0268264_11367384
218 Ga0265318_10153155
219 Ga0307515_10000664
220 Ga0307515_10002453
221 Ga0307515_10333725
222 Ga0307512_10033080
223 Ga0307512_10155698
224 Ga0307512_10239486
225 Ga0265331_10007721
226 Ga0265327_10000229
227 Ga0265327_10000722
228 Ga0307513_10005218
229 Ga0307513_10161285
230 Ga0307509_10163939
231 Ga0307408_100308579
232 Ga0307508_10000123
233 Ga0307514_10000530
234 Ga0307514_10011156
235 Ga0307516_10003862
236 Ga0307411_11126363
237 Ga0373937_0900095
238 Ga0373925_0339322
239 Ga0451802_0444555
240 Ga0451807_2702610
241 Ga0451853_0466856
242 Ga0451576_0105467
243 Ga0495629_0650763
244 Ga0495650_0012739
245 Ga0495597_0018214
246 Ga0495671_0276991
247 Ga0495581_0199085
248 Ga0495672_0000014
249 Ga0496110_0054661
250 Ga0496116_0270634
251 Ga0496121_0029241
252 Ga0496124_0163490
253 nmdc:mga03683_31284_c1
254 nmdc:mga00v17_4332_c1
255 nmdc:mga0yw44_22051_c1
256 nmdc:mga0k408_40621_c1
257 nmdc:mga0k408_56931_c1
258 nmdc:mga06z11_451083_c1
259 nmdc:mga07m45_25419_c1
260 nmdc:mga07m45_52236_c1
261 nmdc:mga09592_470875_c1
262 nmdc:mga0n895_489944_c1
263 Ga0500651_0037545
264 Ga0500593_000696
265 Ga0500616_0000030
266 Ga0500645_048221
267 2643968221
268 2644143626
269 2644161580
270 2644271999
271 2644341379
272 2904451004
273 2904457860
274 2945951066
275 2945974273
276 2954769531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

15

198

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7695 6 190
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7579 6 190
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7514 1 188
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7372 1 188
7kuw-assembly1.cif.gz_A high-throughput design and refinement of stable proteins using sequence-only models 0.6307 133 162
ID Description Score Start End Superfamily
2l7zA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6667 139 163 1.10.10.60
af_A0A1D8PLR7_520_680_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.6409 137 162 3.40.50.80
af_I1KH55_7_194_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.6144 135 162 2.60.120.330
af_Q8INM8_6_71_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5957 132 162 1.10.10.10
af_Q06596_231_293_1.10.238.100 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;YAP1 redox domain. Chain B 0.5545 123 189 1.10.238.100
ID Description Score Start End GO Terms
AF-A0A8B3G858-F1-model_v4 deleted 0.9725 133 187
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9723 110 187 GO:0005524
GO:0005886
GO:0008556
AF-A0A3D2NZ12-F1-model_v4 deleted 0.9716 110 188
AF-A0A2S9FLH2-F1-model_v4 Potassium-transporting ATPase subunit C 0.9708 117 190 GO:0005524
GO:0005886
GO:0008556
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9699 117 188 GO:0005524
GO:0005886
GO:0008556

Map