F172511

General Info

Members Datasets Scaffolds Average Seq Length
138 119 276 217

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100094692|Ga0070665_1000946923
Length 243
Sequence MPSDSPMSQVPAPVPPAYPPTDRTVPTRLRERASYDRELVHSILDEGYLCHLGFIRDGAPVVLPTLYARHGERLYVHGSTGSRPLRGAGADQGLPVCVTVTHLDALVLARSAFHHSANYRSVVVQGTAHQVTDPRERALALDAIVEQAVPGRADDSRRANAKELAATAVIRVDLREVSAKVRAGGPGDEPEDLALPYWSGVVPVTRAYGVPVPADDLDPSVPLPGYLSPGTPRGTVRTGAASC

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
40 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
41 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
55 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
58 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
59 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
60 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
61 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
62 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
63 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
64 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
65 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
66 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
67 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
70 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
71 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
100 2508501039 Frankia saprophytica CN3 Isolate Nodule
101 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
102 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
103 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
104 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
105 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
106 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
107 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
108 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
109 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
110 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
111 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
112 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
113 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
114 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
115 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
116 8002775197 Frankia nepalensis CN7 Isolate Nodule
117 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
118 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
119 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.51
Metatranscriptomes 0
Isolates 14.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 2.9
Rhizoplane 0.72
Rhizosphere 76.81
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100094692 3300005548 Bacteria 2991
2 JGI25406J46586_10005475 3300003203 Bacteria 5888
3 JGI25406J46586_10006939 3300003203 Bacteria 5198
4 Ga0068869_100128426 3300005334 Bacteria 1946
5 Ga0070709_10111167 3300005434 Bacteria 1842
6 Ga0070710_10037995 3300005437 Bacteria 2641
7 Ga0070706_100027664 3300005467 Bacteria 5216
8 Ga0070706_100244185 3300005467 Bacteria 1676
9 Ga0070707_100111598 3300005468 Unclassified 2652
10 Ga0070697_100070797 3300005536 Bacteria 2860
11 Ga0070696_100130085 3300005546 Unclassified 1831
12 Ga0070664_100391295 3300005564 Bacteria 1270
13 Ga0068859_100000205 3300005617 Bacteria 58285
14 Ga0068863_100017191 3300005841 Bacteria 6937
15 Ga0068858_100694841 3300005842 Bacteria 990
16 Ga0068862_100523551 3300005844 Unclassified 1128
17 Ga0081455_10000730 3300005937 Bacteria 42670
18 Ga0081455_10220578 3300005937 Bacteria 1406
19 Ga0081538_10003912 3300005981 Bacteria 13894
20 Ga0081539_10000720 3300005985 Bacteria 66266
21 Ga0081539_10001908 3300005985 Bacteria 32290
22 Ga0075365_10041500 3300006038 Bacteria 3006
23 Ga0075434_100021385 3300006871 Bacteria 6286
24 Ga0075434_100289615 3300006871 Bacteria 1657
25 Ga0097620_100000205 3300006931 Bacteria 58285
26 Ga0114129_10318598 3300009147 Unclassified 2068
27 Ga0157372_11590189 3300013307 Bacteria 752
28 Ga0157376_10940379 3300014969 Bacteria 884
29 Ga0213875_10020202 3300021388 Bacteria 3195
30 Ga0207684_10033040 3300025910 Bacteria 4401
31 Ga0207684_10251389 3300025910 Bacteria 1525
32 Ga0207646_10031709 3300025922 Bacteria 4784
33 Ga0207679_10019273 3300025945 Bacteria 4580
34 Ga0207641_10079699 3300026088 Bacteria 2839
35 Ga0268266_10074787 3300028379 Bacteria 2942
36 Ga0307515_10194027 3300028794 Bacteria 1930
37 Ga0265316_10049778 3300031344 Bacteria 3299
38 Ga0307513_10049520 3300031456 Bacteria 4550
39 Ga0307509_10024186 3300031507 Bacteria 6806
40 Ga0307408_100013840 3300031548 Bacteria 5356
41 Ga0307508_10001235 3300031616 Bacteria 29188
42 Ga0307514_10022882 3300031649 Bacteria 5074
43 Ga0395900_0044701 3300037418 Bacteria 4563
44 Ga0436364_1255200 3300037853 Bacteria 5974
45 Ga0436363_0495812 3300039450 Bacteria 849
46 Ga0436363_1140597 3300039450 Unclassified 2760
47 Ga0436363_1419455 3300039450 Unclassified 906
48 Ga0436362_0225004 3300039453 Unclassified 1264
49 Ga0439436_0001164 3300041404 Bacteria 7467
50 Ga0439439_0005246 3300041406 Bacteria 2954
51 Ga0451853_0490636 3300041512 Bacteria 6019
52 Ga0439457_000244 3300042014 Bacteria 14728
53 Ga0466969_0017860 3300044656 Bacteria 3700
54 Ga0466966_0091222 3300044684 Bacteria 1891
55 Ga0466961_0007434 3300044693 Bacteria 6973
56 Ga0466971_0018080 3300044719 Bacteria 3122
57 Ga0466957_0054164 3300044842 Bacteria 2448
58 Ga0466959_0091102 3300045049 Bacteria 2189
59 Ga0466967_0207596 3300045976 Bacteria 1857
60 Ga0495592_0117358 3300046454 Bacteria 1876
61 Ga0495603_0273243 3300046455 Bacteria 972
62 Ga0495653_0185332 3300046463 Bacteria 1424
63 Ga0495580_0049840 3300046472 Unclassified 2962
64 Ga0495594_0095155 3300046499 Bacteria 1672
65 Ga0495594_0116001 3300046499 Bacteria 1512
66 Ga0495618_0057286 3300046514 Bacteria 2467
67 Ga0495652_0059234 3300046529 Bacteria 3241
68 Ga0495640_0004399 3300046533 Bacteria 11240
69 Ga0495640_0097684 3300046533 Bacteria 1931
70 Ga0495598_0000022 3300046537 Bacteria 24493
71 Ga0495634_0055316 3300046642 Bacteria 2653
72 Ga0495588_0085382 3300046674 Bacteria 1650
73 Ga0495613_0007727 3300046689 Bacteria 7998
74 Ga0495581_0084141 3300047315 Bacteria 1843
75 Ga0495604_0032515 3300047317 Bacteria 4133
76 Ga0495676_0010259 3300047321 Bacteria 8500
77 Ga0495675_0052166 3300047444 Bacteria 2597
78 Ga0496102_0020941 3300048905 Bacteria 5782
79 Ga0496116_0000710 3300048919 Bacteria 42798
80 Ga0496117_0012499 3300048920 Bacteria 7474
81 Ga0496118_0008070 3300048921 Bacteria 10980
82 Ga0496119_0001920 3300048922 Bacteria 23783
83 Ga0501033_0053117 3300049570 Bacteria 3001
84 Ga0501034_0007348 3300049571 Bacteria 11731
85 Ga0501034_0191306 3300049571 Bacteria 2008
86 Ga0501034_0462267 3300049571 Bacteria 1186
87 Ga0501037_0001093 3300049573 Bacteria 20095
88 Ga0501037_0209577 3300049573 Bacteria 1375
89 Ga0501038_0008707 3300049574 Bacteria 9315
90 Ga0501038_0474362 3300049574 Bacteria 959
91 Ga0501040_0004845 3300049576 Bacteria 8718
92 Ga0501043_0003118 3300049579 Bacteria 13748
93 Ga0501046_0007953 3300049580 Bacteria 9276
94 Ga0501047_0001262 3300049581 Bacteria 25039
95 Ga0501047_0051967 3300049581 Bacteria 3961
96 Ga0501047_0093454 3300049581 Bacteria 2887
97 Ga0501048_0008693 3300049582 Bacteria 7654
98 Ga0501067_0001260 3300049583 Bacteria 13764
99 Ga0501068_0004622 3300049584 Bacteria 7491
100 Ga0501069_0017573 3300049585 Bacteria 3852
101 Ga0501070_0007337 3300049586 Bacteria 9360
102 Ga0501071_0000235 3300049587 Bacteria 25360
103 Ga0501072_0009613 3300049588 Bacteria 7353
104 Ga0501073_0037728 3300049589 Bacteria 3429
105 Ga0501074_0042582 3300049590 Bacteria 3285
106 Ga0501076_0018023 3300049592 Bacteria 5373
107 Ga0501083_0004720 3300049744 Bacteria 9629
108 Ga0501035_0003355 3300049822 Bacteria 15340
109 Ga0501035_0014342 3300049822 Bacteria 7316
110 Ga0501044_0004705 3300049823 Bacteria 15256
111 Ga0501044_0152884 3300049823 Bacteria 2289
112 Ga0501044_0170998 3300049823 Bacteria 2144
113 nmdc:mga0yw44_78197_c1 3300050492 Bacteria 2068
114 nmdc:mga05p37_391831_c1 3300050507 Bacteria 1624
115 Ga0500568_0001393 3300053139 Bacteria 15682
116 Ga0500600_0242453 3300053149 Bacteria 814
117 Ga0501084_0037003 3300054114 Bacteria 4077
118 Ga0501082_0039333 3300060353 Bacteria 4079
119 2508671042 2508501039 Bacteria 9978592
120 2676203587 2675902999 Bacteria 9438463
121 2774848163 2773857921 Bacteria 9435764
122 2785345885 2784746763 Bacteria 9783172
123 2793984726 2791355406 Bacteria 11364898
124 2804843595 2802429296 Bacteria 7227771
125 2904770866 2904765812 Bacteria 5369154
126 2908812859 2908811453 Bacteria 5478616
127 2918502373 2918501144 Bacteria 8668083
128 2919425203 2919420072 Bacteria 5390363
129 2919437688 2919432681 Bacteria 5390474
130 2954008951 2954002825 Bacteria 9173742
131 2990093362 2990088156 Bacteria 6657676
132 2997603404 2997600082 Bacteria 9896405
133 3006327536 3006321560 Bacteria 8247479
134 3006397321 3006393351 Bacteria 6615579
135 8002775318 8002775197 Bacteria 10728764
136 8025415777 8025413630 Bacteria 7014048
137 8033690752 8033684223 Bacteria 6906479
138 8056670072 8056667051 Bacteria 6953971
139 Ga0070665_100094692
140 JGI25406J46586_10005475
141 JGI25406J46586_10006939
142 Ga0068869_100128426
143 Ga0070709_10111167
144 Ga0070710_10037995
145 Ga0070706_100027664
146 Ga0070706_100244185
147 Ga0070707_100111598
148 Ga0070697_100070797
149 Ga0070696_100130085
150 Ga0070664_100391295
151 Ga0068859_100000205
152 Ga0068863_100017191
153 Ga0068858_100694841
154 Ga0068862_100523551
155 Ga0081455_10000730
156 Ga0081455_10220578
157 Ga0081538_10003912
158 Ga0081539_10000720
159 Ga0081539_10001908
160 Ga0075365_10041500
161 Ga0075434_100021385
162 Ga0075434_100289615
163 Ga0097620_100000205
164 Ga0114129_10318598
165 Ga0157372_11590189
166 Ga0157376_10940379
167 Ga0213875_10020202
168 Ga0207684_10033040
169 Ga0207684_10251389
170 Ga0207646_10031709
171 Ga0207679_10019273
172 Ga0207641_10079699
173 Ga0268266_10074787
174 Ga0307515_10194027
175 Ga0265316_10049778
176 Ga0307513_10049520
177 Ga0307509_10024186
178 Ga0307408_100013840
179 Ga0307508_10001235
180 Ga0307514_10022882
181 Ga0395900_0044701
182 Ga0436364_1255200
183 Ga0436363_0495812
184 Ga0436363_1140597
185 Ga0436363_1419455
186 Ga0436362_0225004
187 Ga0439436_0001164
188 Ga0439439_0005246
189 Ga0451853_0490636
190 Ga0439457_000244
191 Ga0466969_0017860
192 Ga0466966_0091222
193 Ga0466961_0007434
194 Ga0466971_0018080
195 Ga0466957_0054164
196 Ga0466959_0091102
197 Ga0466967_0207596
198 Ga0495592_0117358
199 Ga0495603_0273243
200 Ga0495653_0185332
201 Ga0495580_0049840
202 Ga0495594_0095155
203 Ga0495594_0116001
204 Ga0495618_0057286
205 Ga0495652_0059234
206 Ga0495640_0004399
207 Ga0495640_0097684
208 Ga0495598_0000022
209 Ga0495634_0055316
210 Ga0495588_0085382
211 Ga0495613_0007727
212 Ga0495581_0084141
213 Ga0495604_0032515
214 Ga0495676_0010259
215 Ga0495675_0052166
216 Ga0496102_0020941
217 Ga0496116_0000710
218 Ga0496117_0012499
219 Ga0496118_0008070
220 Ga0496119_0001920
221 Ga0501033_0053117
222 Ga0501034_0007348
223 Ga0501034_0191306
224 Ga0501034_0462267
225 Ga0501037_0001093
226 Ga0501037_0209577
227 Ga0501038_0008707
228 Ga0501038_0474362
229 Ga0501040_0004845
230 Ga0501043_0003118
231 Ga0501046_0007953
232 Ga0501047_0001262
233 Ga0501047_0051967
234 Ga0501047_0093454
235 Ga0501048_0008693
236 Ga0501067_0001260
237 Ga0501068_0004622
238 Ga0501069_0017573
239 Ga0501070_0007337
240 Ga0501071_0000235
241 Ga0501072_0009613
242 Ga0501073_0037728
243 Ga0501074_0042582
244 Ga0501076_0018023
245 Ga0501083_0004720
246 Ga0501035_0003355
247 Ga0501035_0014342
248 Ga0501044_0004705
249 Ga0501044_0152884
250 Ga0501044_0170998
251 nmdc:mga0yw44_78197_c1
252 nmdc:mga05p37_391831_c1
253 Ga0500568_0001393
254 Ga0500600_0242453
255 Ga0501084_0037003
256 Ga0501082_0039333
257 2508671042
258 2676203587
259 2774848163
260 2785345885
261 2793984726
262 2804843595
263 2904770866
264 2908812859
265 2918502373
266 2919425203
267 2919437688
268 2954008951
269 2990093362
270 2997603404
271 3006327536
272 3006397321
273 8002775318
274 8025415777
275 8033690752
276 8056670072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

36

181

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ybn-assembly1.cif.gz_B structure of the fad and heme binding protein msmeg_4975 from mycobacterium smegmatis 0.9018 18 200
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.8879 4 205
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.8718 4 205
2fur-assembly1.cif.gz_B crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution 0.8249 21 200
2fur-assembly1.cif.gz_B crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution 0.7804 21 200
ID Description Score Start End Superfamily
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9018 18 200 2.30.110.10
2furB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7642 24 200 2.30.110.10
1w3oA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7274 11 172 2.30.110.10
2furB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7106 24 200 2.30.110.10
2fg9A01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6865 19 151 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A6B1JXN6-F1-model_v4 deleted 0.9712 75 202
AF-A0A2V9V2C5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9672 69 205
AF-A0A6B1JXN6-F1-model_v4 deleted 0.9638 75 202
AF-A0A5P0YK34-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9585 2 205
AF-A0A537YY06-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9579 72 205

Map