F172118

General Info

Members Datasets Scaffolds Average Seq Length
138 105 138 194

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100259613|Ga0070660_1002596131
Length 224
Sequence MVTSLILLYAKSNPSLNVLSKVFAVWCALSMNTLFPLEPNWPEGFQYVNDFILPKEENDLINAIRTHELHSFNFHGYEAKRKTASFGYDWSFDRRSLSKGKDIPAGFNSMMDKVASFLLLSSQTFAELLLTEYPAGSVINWHRDAPPFDIIAGISLLSDCTFRLRPHEKAKQRRNSVISFPVRRRSLYIIQGIARSQWQHSIAPVKQTRYSITLRTLKGPGQDH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
65 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
71 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
80 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
81 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
82 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
83 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
84 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
85 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
86 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
87 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
88 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
89 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
90 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
91 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
92 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
93 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
94 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
95 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
96 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
97 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
100 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 0
Rhizosphere 94.2
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1886170 2162886007 Bacteria 206362
2 JGI24751J29686_10072637 3300002459 Bacteria 710
3 rootH2_10243595 3300003320 Unclassified 2297
4 rootH1_10265399 3300003323 Bacteria 4017
5 rootH1_10316110 3300003323 Bacteria 2637
6 Ga0065165_1001034 3300005262 Bacteria 33734
7 Ga0065714_10097435 3300005288 Bacteria 1735
8 Ga0065704_10070159 3300005289 Bacteria 207348
9 Ga0065712_10112235 3300005290 Unclassified 1803
10 Ga0070683_100074173 3300005329 Bacteria 3177
11 Ga0070683_100502800 3300005329 Unclassified 1158
12 Ga0070670_100059440 3300005331 Bacteria 3281
13 Ga0070670_100260589 3300005331 Unclassified 1511
14 Ga0070670_100329235 3300005331 Bacteria 1339
15 Ga0070660_100259613 3300005339 Bacteria 1418
16 Ga0070660_100699185 3300005339 Bacteria 850
17 Ga0070689_100811948 3300005340 Unclassified 823
18 Ga0070661_100155666 3300005344 Bacteria 1729
19 Ga0070661_100483602 3300005344 Bacteria 989
20 Ga0070675_100222015 3300005354 Bacteria 1646
21 Ga0070671_100074946 3300005355 Bacteria 2827
22 Ga0070674_100657557 3300005356 Bacteria 891
23 Ga0070673_100500397 3300005364 Viruses 1099
24 Ga0070688_100337687 3300005365 Bacteria 1099
25 Ga0070688_100361351 3300005365 Bacteria 1065
26 Ga0070659_100005274 3300005366 Bacteria 9278
27 Ga0070659_100336343 3300005366 Bacteria 1264
28 Ga0070678_101329783 3300005456 Bacteria 669
29 Ga0070681_11397492 3300005458 Unclassified 624
30 Ga0068867_100022882 3300005459 Bacteria 4472
31 Ga0070684_100033144 3300005535 Bacteria 4408
32 Ga0070672_100950042 3300005543 Bacteria 761
33 Ga0070664_100075531 3300005564 Bacteria 2894
34 Ga0068857_100193061 3300005577 Bacteria 1855
35 Ga0068859_100211589 3300005617 Bacteria 2025
36 Ga0068858_100493097 3300005842 Bacteria 1183
37 Ga0097620_100211603 3300006931 Bacteria 2025
38 Ga0111539_10246124 3300009094 Unclassified 2082
39 Ga0114129_10028722 3300009147 Bacteria 7881
40 Ga0157369_10202262 3300013105 Bacteria 2084
41 Ga0157369_10319419 3300013105 Bacteria 1614
42 Ga0157374_10092652 3300013296 Bacteria 2883
43 Ga0157374_10413435 3300013296 Bacteria 1347
44 Ga0157372_10085244 3300013307 Bacteria 3583
45 Ga0157372_10168037 3300013307 Bacteria 2537
46 Ga0157372_10526017 3300013307 Bacteria 1379
47 Ga0157372_10549046 3300013307 Bacteria 1347
48 Ga0157372_11161717 3300013307 Bacteria 892
49 Ga0157372_11578602 3300013307 Unclassified 755
50 Ga0163163_10009065 3300014325 Bacteria 8868
51 Ga0163163_10118259 3300014325 Bacteria 2683
52 Ga0157379_10280074 3300014968 Bacteria 1517
53 Ga0207647_10000208 3300025904 Bacteria 47976
54 Ga0207660_10802002 3300025917 Bacteria 768
55 Ga0207657_10149315 3300025919 Bacteria 1904
56 Ga0207649_10272478 3300025920 Unclassified 1227
57 Ga0207650_10004551 3300025925 Bacteria 9485
58 Ga0207644_10066614 3300025931 Bacteria 2623
59 Ga0207690_10424374 3300025932 Bacteria 1064
60 Ga0207691_10510482 3300025940 Bacteria 1020
61 Ga0207661_10009438 3300025944 Bacteria 7000
62 Ga0207661_10201625 3300025944 Bacteria 1749
63 Ga0207679_10015594 3300025945 Bacteria 5027
64 Ga0207679_10094689 3300025945 Bacteria 2319
65 Ga0207651_10329100 3300025960 Unclassified 1280
66 Ga0207651_10367341 3300025960 Bacteria 1216
67 Ga0207658_10738065 3300025986 Bacteria 891
68 Ga0207648_10022946 3300026089 Bacteria 5596
69 Ga0207674_10239015 3300026116 Bacteria 1763
70 Ga0207683_11213451 3300026121 Bacteria 699
71 Ga0209974_10154725 3300027876 Unclassified 829
72 Ga0207428_10124397 3300027907 Bacteria 1976
73 Ga0307408_100130272 3300031548 Bacteria 1961
74 Ga0307408_100192846 3300031548 Bacteria 1643
75 Ga0307413_10715826 3300031824 Unclassified 833
76 Ga0307410_10142465 3300031852 Unclassified 1775
77 Ga0307407_10042393 3300031903 Bacteria 2552
78 Ga0307412_10883736 3300031911 Unclassified 782
79 Ga0307414_10026673 3300032004 Bacteria 3722
80 Ga0307414_10133207 3300032004 Bacteria 1933
81 Ga0307414_10378889 3300032004 Bacteria 1223
82 Ga0307414_10404406 3300032004 Bacteria 1187
83 Ga0307414_10459258 3300032004 Unclassified 1119
84 Ga0307411_10653472 3300032005 Bacteria 911
85 Ga0307415_100903965 3300032126 Unclassified 814
86 Ga0395905_0000001 3300037471 Bacteria 2037079
87 Ga0395901_0265172 3300038443 Bacteria 1787
88 Ga0439431_0007508 3300041997 Bacteria 2433
89 Ga0439445_0181678 3300042004 Unclassified 618
90 Ga0466957_0000395 3300044842 Bacteria 21232
91 Ga0466967_1253757 3300045976 Bacteria 738
92 Ga0495598_0100644 3300046537 Bacteria 956
93 Ga0495668_0072151 3300046616 Unclassified 1897
94 Ga0495672_0049888 3300047320 Bacteria 2475
95 Ga0501303_022484 3300049526 Unclassified 682
96 Ga0501032_0027097 3300049569 Unclassified 3940
97 Ga0501034_0001945 3300049571 Bacteria 26170
98 Ga0501034_0017258 3300049571 Bacteria 7405
99 Ga0501036_0059835 3300049572 Bacteria 3228
100 Ga0501038_0080679 3300049574 Bacteria 2742
101 Ga0501039_0024898 3300049575 Bacteria 4598
102 Ga0501043_0015798 3300049579 Bacteria 5917
103 Ga0501047_0007499 3300049581 Bacteria 10265
104 Ga0501201_000442 3300049651 Bacteria 3822
105 Ga0501202_025835 3300049652 Unclassified 1198
106 Ga0501216_117030 3300049660 Unclassified 604
107 Ga0501217_012203 3300049661 Unclassified 1911
108 Ga0501217_098259 3300049661 Unclassified 829
109 Ga0501227_030497 3300049665 Bacteria 1292
110 Ga0501227_064439 3300049665 Unclassified 944
111 Ga0501235_011311 3300049669 Bacteria 1956
112 Ga0501235_067072 3300049669 Bacteria 846
113 Ga0501236_001116 3300049670 Bacteria 3056
114 Ga0501240_001902 3300049673 Bacteria 2123
115 Ga0501242_001142 3300049674 Unclassified 2603
116 Ga0501243_013507 3300049675 Bacteria 1298
117 Ga0501253_096225 3300049683 Unclassified 688
118 Ga0501257_000274 3300049686 Bacteria 9965
119 Ga0501257_000541 3300049686 Bacteria 7520
120 Ga0501257_018648 3300049686 Bacteria 1620
121 Ga0501259_000121 3300049688 Bacteria 11404
122 Ga0501259_003582 3300049688 Unclassified 2467
123 Ga0501219_001427 3300049703 Bacteria 2301
124 Ga0501221_000043 3300049704 Bacteria 12913
125 Ga0501225_0010854 3300049705 Unclassified 2571
126 Ga0501225_0089348 3300049705 Unclassified 891
127 Ga0501264_000026 3300049761 Bacteria 22924
128 Ga0501266_007588 3300049763 Unclassified 1361
129 Ga0501268_040576 3300049765 Unclassified 875
130 Ga0501044_0003040 3300049823 Bacteria 18988
131 Ga0501212_007331 3300049851 Unclassified 1509
132 Ga0501284_00064 3300050005 Bacteria 33939
133 nmdc:mga05p37_478114_c1 3300050507 Bacteria 1436
134 nmdc:mga06r32_42679_c1 3300050510 Bacteria 4314
135 Ga0500604_0026144 3300053151 Bacteria 1682
136 Ga0500616_0000741 3300053153 Bacteria 37622
137 Ga0500622_0000003 3300053156 Bacteria 613483
138 Ga0500622_0000126 3300053156 Bacteria 80480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10201625 Ga0207661_102016252 178
2 3300032004 Ga0307414_10459258 Ga0307414_104592582 178
3 3300032005 Ga0307411_10653472 Ga0307411_106534722 179
4 3300041997 Ga0439431_0007508 Ga0439431_0007508_29_589 184
5 3300049571 Ga0501034_0017258 Ga0501034_0017258_5953_6522 184
6 3300002459 JGI24751J29686_10072637 JGI24751J29686_100726371 187
7 3300003323 rootH1_10316110 rootH1_103161104 187
8 3300005262 Ga0065165_1001034 Ga0065165_100103411 187
9 3300005290 Ga0065712_10112235 Ga0065712_101122352 187
10 3300005331 Ga0070670_100059440 Ga0070670_1000594402 187
11 3300005331 Ga0070670_100329235 Ga0070670_1003292352 187
12 3300005354 Ga0070675_100222015 Ga0070675_1002220153 187
13 3300005355 Ga0070671_100074946 Ga0070671_1000749463 187
14 3300005543 Ga0070672_100950042 Ga0070672_1009500421 187
15 3300013296 Ga0157374_10092652 Ga0157374_100926522 187
16 3300014325 Ga0163163_10009065 Ga0163163_100090651 187
17 3300025925 Ga0207650_10004551 Ga0207650_100045514 187
18 3300025931 Ga0207644_10066614 Ga0207644_100666141 187
19 3300025940 Ga0207691_10510482 Ga0207691_105104822 187
20 3300025945 Ga0207679_10015594 Ga0207679_100155941 187
21 3300025960 Ga0207651_10367341 Ga0207651_103673411 187
22 3300037471 Ga0395905_0000001 Ga0395905_0000001_1309629_1310195 187
23 3300053151 Ga0500604_0026144 Ga0500604_0026144_142_705 187
24 3300053156 Ga0500622_0000126 Ga0500622_0000126_23485_24048 187
25 2162886007 SwRhRL2b_contig_1886170 SwRhRL2b_0728.00008520 188
26 3300003320 rootH2_10243595 rootH2_102435951 188
27 3300003323 rootH1_10265399 rootH1_102653992 188
28 3300005288 Ga0065714_10097435 Ga0065714_100974352 188
29 3300005289 Ga0065704_10070159 Ga0065704_1007015983 188
30 3300005329 Ga0070683_100074173 Ga0070683_1000741732 188
31 3300005329 Ga0070683_100502800 Ga0070683_1005028002 188
32 3300005331 Ga0070670_100260589 Ga0070670_1002605892 188
33 3300005339 Ga0070660_100259613 Ga0070660_1002596131 188
34 3300005339 Ga0070660_100699185 Ga0070660_1006991851 188
35 3300005340 Ga0070689_100811948 Ga0070689_1008119481 188
36 3300005344 Ga0070661_100155666 Ga0070661_1001556662 188
37 3300005344 Ga0070661_100483602 Ga0070661_1004836022 188
38 3300005356 Ga0070674_100657557 Ga0070674_1006575572 188
39 3300005364 Ga0070673_100500397 Ga0070673_1005003972 188
40 3300005365 Ga0070688_100337687 Ga0070688_1003376872 188
41 3300005365 Ga0070688_100361351 Ga0070688_1003613512 188
42 3300005366 Ga0070659_100005274 Ga0070659_10000527412 188
43 3300005366 Ga0070659_100336343 Ga0070659_1003363431 188
44 3300005456 Ga0070678_101329783 Ga0070678_1013297831 188
45 3300005458 Ga0070681_11397492 Ga0070681_113974921 188
46 3300005459 Ga0068867_100022882 Ga0068867_1000228824 188
47 3300005535 Ga0070684_100033144 Ga0070684_1000331441 188
48 3300005564 Ga0070664_100075531 Ga0070664_1000755315 188
49 3300005577 Ga0068857_100193061 Ga0068857_1001930613 188
50 3300005617 Ga0068859_100211589 Ga0068859_1002115892 188
51 3300005842 Ga0068858_100493097 Ga0068858_1004930972 188
52 3300006931 Ga0097620_100211603 Ga0097620_1002116033 188
53 3300009094 Ga0111539_10246124 Ga0111539_102461241 188
54 3300009147 Ga0114129_10028722 Ga0114129_100287224 188
55 3300013105 Ga0157369_10202262 Ga0157369_102022622 188
56 3300013105 Ga0157369_10319419 Ga0157369_103194192 188
57 3300013296 Ga0157374_10413435 Ga0157374_104134352 188
58 3300013307 Ga0157372_10085244 Ga0157372_100852444 188
59 3300013307 Ga0157372_10168037 Ga0157372_101680374 188
60 3300013307 Ga0157372_10526017 Ga0157372_105260172 188
61 3300013307 Ga0157372_10549046 Ga0157372_105490462 188
62 3300013307 Ga0157372_11161717 Ga0157372_111617171 188
63 3300013307 Ga0157372_11578602 Ga0157372_115786022 188
64 3300014325 Ga0163163_10118259 Ga0163163_101182592 188
65 3300014968 Ga0157379_10280074 Ga0157379_102800742 188
66 3300025904 Ga0207647_10000208 Ga0207647_1000020849 188
67 3300025917 Ga0207660_10802002 Ga0207660_108020021 188
68 3300025919 Ga0207657_10149315 Ga0207657_101493152 188
69 3300025920 Ga0207649_10272478 Ga0207649_102724782 188
70 3300025932 Ga0207690_10424374 Ga0207690_104243741 188
71 3300025944 Ga0207661_10009438 Ga0207661_100094382 188
72 3300025945 Ga0207679_10094689 Ga0207679_100946894 188
73 3300025960 Ga0207651_10329100 Ga0207651_103291002 188
74 3300025986 Ga0207658_10738065 Ga0207658_107380651 188
75 3300026089 Ga0207648_10022946 Ga0207648_100229464 188
76 3300026116 Ga0207674_10239015 Ga0207674_102390152 188
77 3300026121 Ga0207683_11213451 Ga0207683_112134511 188
78 3300027876 Ga0209974_10154725 Ga0209974_101547251 188
79 3300027907 Ga0207428_10124397 Ga0207428_101243972 188
80 3300031548 Ga0307408_100130272 Ga0307408_1001302721 188
81 3300031548 Ga0307408_100192846 Ga0307408_1001928463 188
82 3300031824 Ga0307413_10715826 Ga0307413_107158262 188
83 3300031852 Ga0307410_10142465 Ga0307410_101424653 188
84 3300031903 Ga0307407_10042393 Ga0307407_100423932 188
85 3300031911 Ga0307412_10883736 Ga0307412_108837361 188
86 3300032004 Ga0307414_10026673 Ga0307414_100266732 188
87 3300032004 Ga0307414_10133207 Ga0307414_101332072 188
88 3300032004 Ga0307414_10378889 Ga0307414_103788892 188
89 3300032004 Ga0307414_10404406 Ga0307414_104044062 188
90 3300032126 Ga0307415_100903965 Ga0307415_1009039651 188
91 3300038443 Ga0395901_0265172 Ga0395901_0265172_1037_1612 188
92 3300042004 Ga0439445_0181678 Ga0439445_0181678_18_590 188
93 3300044842 Ga0466957_0000395 Ga0466957_0000395_6926_7507 188
94 3300045976 Ga0466967_1253757 Ga0466967_1253757_12_596 188
95 3300046537 Ga0495598_0100644 Ga0495598_0100644_181_747 188
96 3300046616 Ga0495668_0072151 Ga0495668_0072151_365_967 188
97 3300047320 Ga0495672_0049888 Ga0495672_0049888_1374_1940 188
98 3300049526 Ga0501303_022484 Ga0501303_022484_38_610 188
99 3300049569 Ga0501032_0027097 Ga0501032_0027097_3115_3729 188
100 3300049571 Ga0501034_0001945 Ga0501034_0001945_24234_24848 188
101 3300049572 Ga0501036_0059835 Ga0501036_0059835_48_662 188
102 3300049574 Ga0501038_0080679 Ga0501038_0080679_753_1367 188
103 3300049575 Ga0501039_0024898 Ga0501039_0024898_2207_2821 188
104 3300049579 Ga0501043_0015798 Ga0501043_0015798_3858_4472 188
105 3300049581 Ga0501047_0007499 Ga0501047_0007499_7329_7943 188
106 3300049651 Ga0501201_000442 Ga0501201_000442_2534_3112 188
107 3300049652 Ga0501202_025835 Ga0501202_025835_147_800 188
108 3300049660 Ga0501216_117030 Ga0501216_117030_19_591 188
109 3300049661 Ga0501217_012203 Ga0501217_012203_752_1405 188
110 3300049661 Ga0501217_098259 Ga0501217_098259_131_703 188
111 3300049665 Ga0501227_030497 Ga0501227_030497_321_899 188
112 3300049665 Ga0501227_064439 Ga0501227_064439_21_593 188
113 3300049669 Ga0501235_011311 Ga0501235_011311_618_1196 188
114 3300049669 Ga0501235_067072 Ga0501235_067072_130_705 188
115 3300049670 Ga0501236_001116 Ga0501236_001116_1477_2061 188
116 3300049673 Ga0501240_001902 Ga0501240_001902_225_818 188
117 3300049674 Ga0501242_001142 Ga0501242_001142_801_1454 188
118 3300049675 Ga0501243_013507 Ga0501243_013507_592_1170 188
119 3300049683 Ga0501253_096225 Ga0501253_096225_55_627 188
120 3300049686 Ga0501257_000274 Ga0501257_000274_6687_7256 188
121 3300049686 Ga0501257_000541 Ga0501257_000541_4285_4869 188
122 3300049686 Ga0501257_018648 Ga0501257_018648_208_783 188
123 3300049688 Ga0501259_000121 Ga0501259_000121_10709_11287 188
124 3300049688 Ga0501259_003582 Ga0501259_003582_710_1363 188
125 3300049703 Ga0501219_001427 Ga0501219_001427_1452_2039 188
126 3300049704 Ga0501221_000043 Ga0501221_000043_2966_3544 188
127 3300049705 Ga0501225_0010854 Ga0501225_0010854_1346_1915 188
128 3300049705 Ga0501225_0089348 Ga0501225_0089348_175_774 188
129 3300049761 Ga0501264_000026 Ga0501264_000026_1108_1692 188
130 3300049763 Ga0501266_007588 Ga0501266_007588_350_1003 188
131 3300049765 Ga0501268_040576 Ga0501268_040576_68_640 188
132 3300049823 Ga0501044_0003040 Ga0501044_0003040_1185_1799 188
133 3300049851 Ga0501212_007331 Ga0501212_007331_233_886 188
134 3300050005 Ga0501284_00064 Ga0501284_00064_7898_8485 188
135 3300050507 nmdc:mga05p37_478114_c1 nmdc:mga05p37_478114_c1_433_999 188
136 3300050510 nmdc:mga06r32_42679_c1 nmdc:mga06r32_42679_c1_2407_2973 188
137 3300053153 Ga0500616_0000741 Ga0500616_0000741_4558_5127 188
138 3300053156 Ga0500622_0000003 Ga0500622_0000003_379825_380427 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

44

216

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h68-assembly1.cif.gz_A crystal structure of caenorhabditis elegans nmad-1 in complex with nog and mg(ii) 0.8393 13 187
7x85-assembly2.cif.gz_C crystal structure of chicken cenp-c cupin domain 0.824 97 188
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8239 34 188
4z82-assembly1.cif.gz_A cysteine bound rat cysteine dioxygenase c164s variant at ph 8.1 0.8174 97 188
6xwu-assembly1.cif.gz_A-2 crystal structure of drosophila melanogaster cenp-c cumin domain 0.8168 98 186
ID Description Score Start End Superfamily
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8581 97 188 2.60.120.10
af_Q9D8F1_130_273_2.60.120.1520 Mainly Beta;Sandwich;Jelly Rolls; 0.8541 78 187 2.60.120.1520
af_Q9VL81_65_278_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8526 8 188 2.60.120.590
af_A4IB22_54_194_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8496 67 187 2.60.120.590
af_Q8MNT9_76_265_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8421 9 187 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A4R1BC65-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9904 11 187 GO:0032451
GO:0051213
GO:0070988
AF-A0A4V2A9I9-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9758 1 188 GO:0032451
GO:0051213
GO:0070988
AF-A0A4V2A9I9-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9707 1 188 GO:0032451
GO:0051213
GO:0070988
AF-A0A1M4YER1-F1-model_v4 Alkylated DNA repair dioxygenase AlkB 0.969 1 188 GO:0032451
GO:0051213
GO:0070988
AF-A0A4R1BC65-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9686 11 187 GO:0032451
GO:0051213
GO:0070988

Feature Viewer

pLDDT pTM Quality
93.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map