F170503

General Info

Members Datasets Scaffolds Average Seq Length
137 37 274 135

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0059856|Ga0316574_0059856_455_904
Length 149
Sequence MSEAGKVIRVIRVRDVMKVGVDMVDGLTTVADALRMMKYVDTNTLIVNKRNEDDEYGIVLLSDIAREVLAKDRAPERVNVYEIMAKPVISVEPSLDIRYCARLFDKFGLARAPVIENGAVIGIVSYTDMVLKGLCADIPGGPPPSGGGR

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
3 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
4 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
5 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
6 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
7 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
8 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
9 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
10 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
13 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
14 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
15 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
16 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
17 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
18 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
19 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
20 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
21 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
22 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
23 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
24 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
25 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
26 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
27 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
28 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
29 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
30 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
31 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
32 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
33 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
34 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
35 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
36 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
37 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 2.19
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 23.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0059856 3300035398 Bacteria 2389
2 Ga0316575_10001150 3300031665 Bacteria 8294
3 Ga0316575_10010738 3300031665 Bacteria 3373
4 Ga0316575_10015542 3300031665 Unclassified 2870
5 Ga0316575_10018420 3300031665 Bacteria 2661
6 Ga0316575_10060352 3300031665 Unclassified 1515
7 Ga0316575_10264872 3300031665 Bacteria 722
8 Ga0316579_10080907 3300031691 Bacteria 1546
9 Ga0316579_10085127 3300031691 Bacteria 1508
10 Ga0316579_10133241 3300031691 Unclassified 1197
11 Ga0316579_10220251 3300031691 Bacteria 918
12 Ga0316576_10007292 3300031727 Bacteria 6948
13 Ga0316576_10010128 3300031727 Bacteria 6110
14 Ga0316576_10056413 3300031727 Bacteria 2869
15 Ga0316576_10071267 3300031727 Unclassified 2563
16 Ga0316576_10077107 3300031727 Bacteria 2467
17 Ga0316576_10098872 3300031727 Bacteria 2179
18 Ga0316576_10283145 3300031727 Unclassified 1241
19 Ga0316576_10324325 3300031727 Unclassified 1148
20 Ga0316576_10403773 3300031727 Bacteria 1012
21 Ga0316576_10518409 3300031727 Bacteria 876
22 Ga0316576_10756818 3300031727 Unclassified 701
23 Ga0316576_10764152 3300031727 Bacteria 697
24 Ga0316576_11010976 3300031727 Unclassified 592
25 Ga0316578_10018101 3300031728 Bacteria 3851
26 Ga0316578_10055013 3300031728 Bacteria 2334
27 Ga0316578_10070202 3300031728 Bacteria 2073
28 Ga0316578_10123944 3300031728 Bacteria 1554
29 Ga0316578_10126992 3300031728 Bacteria 1534
30 Ga0316578_10182949 3300031728 Bacteria 1263
31 Ga0316578_10239720 3300031728 Bacteria 1089
32 Ga0316578_10353294 3300031728 Unclassified 875
33 Ga0316578_10681984 3300031728 Unclassified 599
34 Ga0316578_10813082 3300031728 Bacteria 541
35 Ga0316577_10030291 3300031733 Bacteria 3020
36 Ga0316577_10110150 3300031733 Bacteria 1545
37 Ga0316577_10170129 3300031733 Unclassified 1229
38 Ga0316577_10226198 3300031733 Bacteria 1058
39 Ga0316583_10006077 3300032133 Bacteria 4341
40 Ga0316583_10035643 3300032133 Bacteria 1765
41 Ga0316583_10039133 3300032133 Unclassified 1679
42 Ga0316585_10211757 3300032137 Unclassified 641
43 Ga0316580_10007817 3300032139 Bacteria 3191
44 Ga0316580_10011017 3300032139 Bacteria 2740
45 Ga0316580_10016632 3300032139 Bacteria 2258
46 Ga0316580_10025184 3300032139 Bacteria 1839
47 Ga0316580_10074002 3300032139 Bacteria 1043
48 Ga0316580_10200028 3300032139 Bacteria 616
49 Ga0316593_10099889 3300032168 Bacteria 1028
50 Ga0316593_10280503 3300032168 Unclassified 628
51 Ga0316596_1085436 3300033541 Unclassified 849
52 Ga0316574_0000366 3300035398 Bacteria 17558
53 Ga0316574_0003090 3300035398 Bacteria 8497
54 Ga0316574_0004926 3300035398 Bacteria 7072
55 Ga0316574_0008402 3300035398 Bacteria 5731
56 Ga0316574_0008798 3300035398 Bacteria 5624
57 Ga0316574_0009725 3300035398 Bacteria 5400
58 Ga0316574_0041551 3300035398 Bacteria 2835
59 Ga0316574_0048517 3300035398 Bacteria 2637
60 Ga0316574_0059030 3300035398 Bacteria 2404
61 Ga0316574_0083911 3300035398 Bacteria 2026
62 Ga0316574_0087965 3300035398 Bacteria 1978
63 Ga0316574_0089563 3300035398 Bacteria 1960
64 Ga0316574_0091574 3300035398 Bacteria 1939
65 Ga0316574_0117652 3300035398 Bacteria 1705
66 Ga0316574_0120936 3300035398 Bacteria 1681
67 Ga0316574_0255395 3300035398 Bacteria 1120
68 Ga0316574_0299132 3300035398 Unclassified 1023
69 Ga0316574_0374310 3300035398 Bacteria 899
70 Ga0316574_0504723 3300035398 Unclassified 754
71 Ga0316574_0554155 3300035398 Bacteria 713
72 Ga0316574_0677848 3300035398 Bacteria 633
73 Ga0316574_0991085 3300035398 Unclassified 506
74 Ga0316582_0000972 3300036647 Bacteria 11917
75 Ga0316582_0002573 3300036647 Bacteria 8594
76 Ga0316582_0007642 3300036647 Bacteria 5767
77 Ga0316582_0008341 3300036647 Bacteria 5562
78 Ga0316582_0024761 3300036647 Bacteria 3595
79 Ga0316582_0048603 3300036647 Unclassified 2683
80 Ga0316582_0102258 3300036647 Bacteria 1899
81 Ga0316582_0103364 3300036647 Bacteria 1889
82 Ga0316582_0196435 3300036647 Unclassified 1375
83 Ga0316582_0295389 3300036647 Bacteria 1113
84 Ga0316582_0316042 3300036647 Bacteria 1073
85 Ga0316582_0397812 3300036647 Bacteria 949
86 Ga0316582_0566596 3300036647 Unclassified 782
87 Ga0316584_0020336 3300036712 Bacteria 4811
88 Ga0316584_0027821 3300036712 Bacteria 4163
89 Ga0316584_0035958 3300036712 Bacteria 3674
90 Ga0316584_0049591 3300036712 Bacteria 3138
91 Ga0316584_0095809 3300036712 Bacteria 2221
92 Ga0316584_0102187 3300036712 Bacteria 2147
93 Ga0316584_0120012 3300036712 Unclassified 1965
94 Ga0316584_0123622 3300036712 Bacteria 1933
95 Ga0316584_0139771 3300036712 Unclassified 1807
96 Ga0316584_0147359 3300036712 Bacteria 1753
97 Ga0316584_0286889 3300036712 Bacteria 1195
98 Ga0316584_0316670 3300036712 Bacteria 1126
99 Ga0316584_0340576 3300036712 Bacteria 1078
100 Ga0316584_0427403 3300036712 Bacteria 940
101 Ga0316584_0483466 3300036712 Bacteria 872
102 Ga0316584_0604026 3300036712 Bacteria 761
103 Ga0316584_0689194 3300036712 Unclassified 701
104 Ga0316584_0728643 3300036712 Bacteria 678
105 Ga0316581_0034673 3300037588 Bacteria 1527
106 Ga0316581_0108515 3300037588 Bacteria 855
107 Ga0400484_08526 3300038725 Bacteria 1391
108 Ga0400484_35755 3300038725 Bacteria 5443
109 Ga0400490_36928 3300038726 Bacteria 22228
110 Ga0400490_50015 3300038726 Bacteria 29938
111 Ga0400491_18744 3300038727 Bacteria 2298
112 Ga0400488_49743 3300038741 Bacteria 3669
113 Ga0400488_63401 3300038741 Bacteria 1387
114 Ga0400483_099644 3300039062 Bacteria 3666
115 Ga0400483_186349 3300039062 Bacteria 2181
116 Ga0400483_222263 3300039062 Bacteria 1413
117 Ga0400483_234988 3300039062 Bacteria 4827
118 Ga0400489_33478 3300039093 Bacteria 3798
119 Ga0400487_42326 3300039110 Bacteria 35782
120 Ga0400487_44301 3300039110 Bacteria 1525
121 Ga0400487_56290 3300039110 Bacteria 1622
122 Ga0451577_0386359 3300042876 Bacteria 1270
123 Ga0453684_0218707 3300044712 Bacteria 2208
124 Ga0451576_0000077 3300045051 Bacteria 243265
125 Ga0501037_0820624 3300049573 Unclassified 613
126 Ga0501041_0128356 3300049577 Unclassified 1579
127 Ga0501042_1250662 3300049578 Unclassified 541
128 Ga0501071_0048570 3300049587 Bacteria 3053
129 Ga0501072_0622435 3300049588 Unclassified 850
130 Ga0501074_0505190 3300049590 Bacteria 856
131 Ga0501076_0150380 3300049592 Unclassified 1894
132 Ga0501080_0193478 3300049742 Unclassified 1868
133 Ga0501035_0856547 3300049822 Unclassified 723
134 Ga0501082_0246366 3300060353 Bacteria 1555
135 Ga0530510_1126673 3300061734 Unclassified 601
136 2836160626 2836160341 Unclassified 5867367
137 8001525039 8001522603 Bacteria 4726425
138 Ga0316574_0059856
139 Ga0316575_10001150
140 Ga0316575_10010738
141 Ga0316575_10015542
142 Ga0316575_10018420
143 Ga0316575_10060352
144 Ga0316575_10264872
145 Ga0316579_10080907
146 Ga0316579_10085127
147 Ga0316579_10133241
148 Ga0316579_10220251
149 Ga0316576_10007292
150 Ga0316576_10010128
151 Ga0316576_10056413
152 Ga0316576_10071267
153 Ga0316576_10077107
154 Ga0316576_10098872
155 Ga0316576_10283145
156 Ga0316576_10324325
157 Ga0316576_10403773
158 Ga0316576_10518409
159 Ga0316576_10756818
160 Ga0316576_10764152
161 Ga0316576_11010976
162 Ga0316578_10018101
163 Ga0316578_10055013
164 Ga0316578_10070202
165 Ga0316578_10123944
166 Ga0316578_10126992
167 Ga0316578_10182949
168 Ga0316578_10239720
169 Ga0316578_10353294
170 Ga0316578_10681984
171 Ga0316578_10813082
172 Ga0316577_10030291
173 Ga0316577_10110150
174 Ga0316577_10170129
175 Ga0316577_10226198
176 Ga0316583_10006077
177 Ga0316583_10035643
178 Ga0316583_10039133
179 Ga0316585_10211757
180 Ga0316580_10007817
181 Ga0316580_10011017
182 Ga0316580_10016632
183 Ga0316580_10025184
184 Ga0316580_10074002
185 Ga0316580_10200028
186 Ga0316593_10099889
187 Ga0316593_10280503
188 Ga0316596_1085436
189 Ga0316574_0000366
190 Ga0316574_0003090
191 Ga0316574_0004926
192 Ga0316574_0008402
193 Ga0316574_0008798
194 Ga0316574_0009725
195 Ga0316574_0041551
196 Ga0316574_0048517
197 Ga0316574_0059030
198 Ga0316574_0083911
199 Ga0316574_0087965
200 Ga0316574_0089563
201 Ga0316574_0091574
202 Ga0316574_0117652
203 Ga0316574_0120936
204 Ga0316574_0255395
205 Ga0316574_0299132
206 Ga0316574_0374310
207 Ga0316574_0504723
208 Ga0316574_0554155
209 Ga0316574_0677848
210 Ga0316574_0991085
211 Ga0316582_0000972
212 Ga0316582_0002573
213 Ga0316582_0007642
214 Ga0316582_0008341
215 Ga0316582_0024761
216 Ga0316582_0048603
217 Ga0316582_0102258
218 Ga0316582_0103364
219 Ga0316582_0196435
220 Ga0316582_0295389
221 Ga0316582_0316042
222 Ga0316582_0397812
223 Ga0316582_0566596
224 Ga0316584_0020336
225 Ga0316584_0027821
226 Ga0316584_0035958
227 Ga0316584_0049591
228 Ga0316584_0095809
229 Ga0316584_0102187
230 Ga0316584_0120012
231 Ga0316584_0123622
232 Ga0316584_0139771
233 Ga0316584_0147359
234 Ga0316584_0286889
235 Ga0316584_0316670
236 Ga0316584_0340576
237 Ga0316584_0427403
238 Ga0316584_0483466
239 Ga0316584_0604026
240 Ga0316584_0689194
241 Ga0316584_0728643
242 Ga0316581_0034673
243 Ga0316581_0108515
244 Ga0400484_08526
245 Ga0400484_35755
246 Ga0400490_36928
247 Ga0400490_50015
248 Ga0400491_18744
249 Ga0400488_49743
250 Ga0400488_63401
251 Ga0400483_099644
252 Ga0400483_186349
253 Ga0400483_222263
254 Ga0400483_234988
255 Ga0400489_33478
256 Ga0400487_42326
257 Ga0400487_44301
258 Ga0400487_56290
259 Ga0451577_0386359
260 Ga0453684_0218707
261 Ga0451576_0000077
262 Ga0501037_0820624
263 Ga0501041_0128356
264 Ga0501042_1250662
265 Ga0501071_0048570
266 Ga0501072_0622435
267 Ga0501074_0505190
268 Ga0501076_0150380
269 Ga0501080_0193478
270 Ga0501035_0856547
271 Ga0501082_0246366
272 Ga0530510_1126673
273 2836160626
274 8001525039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

80

133

0.95

PF00571

CBS

CBS domain

13

70

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npl-assembly1.cif.gz_A crystal structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria, yb-derivative at 2.8 a resolution 0.9723 6 126
5nmu-assembly1.cif.gz_B-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.9623 7 129
5nmu-assembly1.cif.gz_C-2 structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria 0.9592 5 127
2yzi-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from pyrococcus horikoshii 0.8991 6 128
3ghd-assembly1.cif.gz_A crystal structure of a cystathionine beta-synthase domain protein fused to a zn-ribbon-like domain 0.8901 16 82
ID Description Score Start End Superfamily
3oi8B01 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9234 87 121 3.10.580.10
af_P33360_240_308_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9062 86 126 3.10.580.10
af_C0PHI9_226_352_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.897 9 132 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8894 15 131 3.10.580.10
af_Q58069_5_184_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8866 5 136 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A4Z0LX91-F1-model_v4 CBS domain-containing protein 0.9942 2 134
AF-A0A7Y4RXR0-F1-model_v4 CBS domain-containing protein 0.9877 1 134
AF-A0A418RSP1-F1-model_v4 CBS domain-containing protein 0.9876 12 132
AF-A0A3S0KGT1-F1-model_v4 CBS domain-containing protein 0.9822 1 134
AF-A0A2W1J8N9-F1-model_v4 Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) 0.9802 7 129 GO:0003938

Map