F170451

General Info

Members Datasets Scaffolds Average Seq Length
137 116 124 380

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0002478|Ga0373926_0002478_590_1807
Length 405
Sequence MSYLPGGTMSQGSSQAGAGRHRAPAIAGLGITDVGKVYGPTAAQFAAEAVRLAVADAGLALADLDGLLTSGGVSRGVGLGLQRDLGLRDLRLLCEMNAFGSTAGAMVQFASMAVQAGMADVVACVFADAPLRPDRGAGAVYRGSRTPAGWLGLLPASGIRGANPMYALAARRHMLRYGTTSEQLGAIAVAQRGWAALNPRAQLREEITIGDYLASRWIAEPFRLLDCCLVSNGGIAVIVTTAERAASLASPPVYVLGWGQGHPGHSMRRDDEFGLRTGAAVSGPAALAMAGVTLADVDVAELYDCYTFTVLITLEDYGFCAKGEGGPFAASGVLGPAGSLKVNTGGGQLSSYYLWGMTPLSEAVLQARGMAGRRQVPGHDVVLVSGNGGVLDYHSTLVLSPHQRG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
5 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
6 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
7 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
8 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
9 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
10 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
11 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
116 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.78
Metatranscriptomes 0.73
Isolates 9.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.65
Nodule 0
Rhizoplane 2.92
Rhizosphere 75.91
Stem 0
Stem Tuber 0
Unclassified 17.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002413 3300002067 Bacteria 6499
2 JGI25165J46597_1000133 3300003214 Bacteria 124543
3 rootH1_10055548 3300003323 Bacteria 16297
4 Ga0070667_100001413 3300005367 Bacteria 21486
5 Ga0070714_100057494 3300005435 Bacteria 3330
6 Ga0070681_10024494 3300005458 Bacteria 6074
7 Ga0070706_100020666 3300005467 Bacteria 6066
8 Ga0070707_100139943 3300005468 Bacteria 2355
9 Ga0070707_100155986 3300005468 Bacteria 2224
10 Ga0070698_100190876 3300005471 Unclassified 1986
11 Ga0070699_100190074 3300005518 Bacteria 1824
12 Ga0070684_100172982 3300005535 Bacteria 1962
13 Ga0070684_100383412 3300005535 Bacteria 1295
14 Ga0070704_100001854 3300005549 Bacteria 11655
15 Ga0068856_100006210 3300005614 Bacteria 11725
16 Ga0068863_100001873 3300005841 Bacteria 20912
17 Ga0068862_100111681 3300005844 Bacteria 2400
18 Ga0081455_10000815 3300005937 Bacteria 40097
19 Ga0081539_10002034 3300005985 Bacteria 30466
20 Ga0075428_100052539 3300006844 Bacteria 4466
21 Ga0105251_10040825 3300009011 Bacteria 2261
22 Ga0105240_10035403 3300009093 Bacteria 6434
23 Ga0105247_10002131 3300009101 Bacteria 13676
24 Ga0114129_10144450 3300009147 Bacteria 3260
25 Ga0105243_10008562 3300009148 Bacteria 7849
26 Ga0105248_10014561 3300009177 Bacteria 8657
27 Ga0105237_10050728 3300009545 Bacteria 4169
28 Ga0105238_10197408 3300009551 Bacteria 1988
29 Ga0105239_10022118 3300010375 Bacteria 7008
30 Ga0105239_10441694 3300010375 Bacteria 1475
31 Ga0157371_10237636 3300013102 Bacteria 1310
32 Ga0157370_10230720 3300013104 Bacteria 1713
33 Ga0157369_10002895 3300013105 Bacteria 20503
34 Ga0157369_10193303 3300013105 Bacteria 2137
35 Ga0157375_10230443 3300013308 Bacteria 2011
36 Ga0163163_10082926 3300014325 Bacteria 3211
37 Ga0182008_10019539 3300014497 Bacteria 3496
38 Ga0182008_10021953 3300014497 Bacteria 3272
39 Ga0157379_10073710 3300014968 Bacteria 3056
40 Ga0163161_10040149 3300017792 Bacteria 3361
41 Ga0206353_11981227 3300020082 Bacteria 2235
42 Ga0209437_101779 3300025233 Bacteria 4655
43 Ga0209759_1001559 3300025256 Bacteria 12527
44 Ga0209233_1000042 3300025261 Bacteria 510519
45 Ga0209025_1001275 3300025294 Bacteria 34648
46 Ga0207710_10000882 3300025900 Bacteria 16096
47 Ga0207707_10171875 3300025912 Bacteria 1894
48 Ga0207695_10107830 3300025913 Bacteria 2770
49 Ga0207671_10022614 3300025914 Bacteria 4750
50 Ga0207671_10147078 3300025914 Bacteria 1818
51 Ga0207646_10121207 3300025922 Bacteria 2349
52 Ga0207659_10267101 3300025926 Bacteria 1394
53 Ga0207700_10319124 3300025928 Bacteria 1346
54 Ga0207711_10004563 3300025941 Bacteria 11781
55 Ga0207668_10017028 3300025972 Bacteria 4548
56 Ga0207658_10029647 3300025986 Bacteria 3867
57 Ga0207703_10109152 3300026035 Bacteria 2358
58 Ga0207678_10021596 3300026067 Bacteria 5644
59 Ga0207641_10020368 3300026088 Bacteria 5447
60 Ga0268264_10263505 3300028381 Bacteria 1607
61 Ga0307513_10084282 3300031456 Bacteria 3265
62 Ga0307408_100000067 3300031548 Bacteria 120790
63 Ga0307514_10072196 3300031649 Bacteria 2585
64 Ga0265314_10023752 3300031711 Bacteria 4666
65 Ga0373926_0002478 3300035083 Bacteria 5860
66 Ga0373947_0000016 3300035725 Bacteria 124284
67 Ga0373937_0005057 3300036401 Bacteria 11228
68 Ga0395900_0310536 3300037418 Bacteria 1560
69 Ga0395898_0265241 3300037466 Bacteria 1638
70 Ga0436364_0218794 3300037853 Unclassified 1517
71 Ga0436364_1047218 3300037853 Bacteria 2994
72 Ga0453683_0000588 3300044673 Bacteria 40294
73 Ga0466966_0000723 3300044684 Bacteria 20971
74 Ga0466966_0018666 3300044684 Bacteria 4571
75 Ga0466961_0067296 3300044693 Bacteria 2275
76 Ga0466971_0003626 3300044719 Bacteria 6596
77 Ga0466957_0117619 3300044842 Bacteria 1692
78 Ga0466959_0003212 3300045049 Bacteria 10629
79 Ga0466959_0188557 3300045049 Bacteria 1440
80 Ga0451576_0001358 3300045051 Bacteria 42179
81 Ga0466958_0042597 3300045836 Bacteria 2734
82 Ga0466967_0041578 3300045976 Bacteria 3965
83 Ga0495580_0048684 3300046472 Bacteria 2999
84 Ga0496102_0000846 3300048905 Bacteria 29425
85 Ga0496102_0001687 3300048905 Bacteria 19374
86 Ga0496103_0000860 3300048906 Bacteria 22092
87 Ga0496115_0070995 3300048918 Bacteria 2824
88 Ga0496116_0001425 3300048919 Bacteria 26878
89 Ga0496117_0001306 3300048920 Bacteria 36677
90 Ga0496118_0001856 3300048921 Bacteria 30242
91 Ga0496119_0002115 3300048922 Bacteria 22378
92 Ga0496119_0013837 3300048922 Bacteria 6377
93 Ga0496120_0000965 3300048923 Bacteria 39237
94 Ga0496124_0101281 3300048927 Bacteria 2334
95 Ga0496125_0000085 3300048928 Bacteria 218570
96 Ga0496126_0090606 3300048929 Bacteria 2690
97 Ga0501031_0035389 3300049568 Bacteria 3257
98 Ga0501032_0000013 3300049569 Bacteria 185070
99 Ga0501032_0000213 3300049569 Bacteria 48075
100 Ga0501033_0000427 3300049570 Bacteria 40245
101 Ga0501033_0001058 3300049570 Bacteria 25160
102 Ga0501034_0000054 3300049571 Bacteria 206373
103 Ga0501034_0000569 3300049571 Bacteria 58487
104 Ga0501034_0035271 3300049571 Bacteria 5072
105 Ga0501036_0000031 3300049572 Bacteria 92249
106 Ga0501036_0000562 3300049572 Bacteria 26673
107 Ga0501037_0000096 3300049573 Bacteria 81773
108 Ga0501037_0000791 3300049573 Bacteria 23790
109 Ga0501038_0000018 3300049574 Bacteria 155191
110 Ga0501038_0000124 3300049574 Bacteria 64786
111 Ga0501039_0000018 3300049575 Bacteria 176187
112 Ga0501039_0000095 3300049575 Bacteria 61547
113 Ga0501041_0021890 3300049577 Bacteria 3829
114 Ga0501043_0000014 3300049579 Bacteria 184687
115 Ga0501043_0000331 3300049579 Bacteria 42804
116 Ga0501046_0166094 3300049580 Bacteria 1658
117 Ga0501035_0000019 3300049822 Bacteria 241152
118 Ga0501035_0000204 3300049822 Bacteria 72214
119 Ga0501044_0003562 3300049823 Bacteria 17529
120 nmdc:mga05p37_277678_c1 3300050507 Bacteria 1999
121 nmdc:mga0qj67_238719_c1 3300050509 Bacteria 1474
122 nmdc:mga08y16_145758_c1 3300050511 Bacteria 2461
123 Ga0500554_030953 3300053102 Bacteria 1576
124 Ga0466962_0035310 3300061719 Bacteria 2393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0117619 Ga0466957_0117619_538_1662 341
2 3300006844 Ga0075428_100052539 Ga0075428_1000525395 342
3 3300009147 Ga0114129_10144450 Ga0114129_101444503 342
4 3300050507 nmdc:mga05p37_277678_c1 nmdc:mga05p37_277678_c1_63_1232 342
5 3300053102 Ga0500554_030953 Ga0500554_030953_228_1394 346
6 3300003323 rootH1_10055548 rootH1_1005554811 348
7 3300010375 Ga0105239_10441694 Ga0105239_104416942 348
8 3300014325 Ga0163163_10082926 Ga0163163_100829263 348
9 3300026035 Ga0207703_10109152 Ga0207703_101091522 348
10 3300028381 Ga0268264_10263505 Ga0268264_102635052 348
11 3300050509 nmdc:mga0qj67_238719_c1 nmdc:mga0qj67_238719_c1_99_1268 348
12 3300050511 nmdc:mga08y16_145758_c1 nmdc:mga08y16_145758_c1_850_2019 348
13 3300013308 Ga0157375_10230443 Ga0157375_102304432 350
14 3300048927 Ga0496124_0101281 Ga0496124_0101281_535_1713 352
15 3300048929 Ga0496126_0090606 Ga0496126_0090606_196_1383 352
16 3300005841 Ga0068863_100001873 Ga0068863_10000187311 353
17 3300009011 Ga0105251_10040825 Ga0105251_100408252 353
18 3300009101 Ga0105247_10002131 Ga0105247_100021316 353
19 3300009177 Ga0105248_10014561 Ga0105248_100145612 353
20 3300014968 Ga0157379_10073710 Ga0157379_100737103 353
21 3300025900 Ga0207710_10000882 Ga0207710_100008827 353
22 3300025928 Ga0207700_10319124 Ga0207700_103191241 353
23 3300025941 Ga0207711_10004563 Ga0207711_100045632 353
24 3300026088 Ga0207641_10020368 Ga0207641_100203683 353
25 3300037418 Ga0395900_0310536 Ga0395900_0310536_11_1117 354
26 3300048922 Ga0496119_0002115 Ga0496119_0002115_18483_19610 354
27 3300048923 Ga0496120_0000965 Ga0496120_0000965_33329_34456 354
28 3300005985 Ga0081539_10002034 Ga0081539_1000203413 356
29 3300048928 Ga0496125_0000085 Ga0496125_0000085_152031_153155 360
30 3300005367 Ga0070667_100001413 Ga0070667_1000014133 362
31 3300005614 Ga0068856_100006210 Ga0068856_1000062103 362
32 3300009093 Ga0105240_10035403 Ga0105240_100354033 362
33 3300009545 Ga0105237_10050728 Ga0105237_100507283 362
34 3300009551 Ga0105238_10197408 Ga0105238_101974083 362
35 3300010375 Ga0105239_10022118 Ga0105239_100221187 362
36 3300025914 Ga0207671_10022614 Ga0207671_100226143 362
37 3300025986 Ga0207658_10029647 Ga0207658_100296473 362
38 3300003214 JGI25165J46597_1000133 JGI25165J46597_10001337 363
39 3300025233 Ga0209437_101779 Ga0209437_1017794 363
40 3300025261 Ga0209233_1000042 Ga0209233_1000042118 363
41 3300048905 Ga0496102_0000846 Ga0496102_0000846_10411_11574 363
42 3300048906 Ga0496103_0000860 Ga0496103_0000860_19515_20678 363
43 3300048919 Ga0496116_0001425 Ga0496116_0001425_17863_19026 363
44 3300048920 Ga0496117_0001306 Ga0496117_0001306_17871_19034 363
45 3300048921 Ga0496118_0001856 Ga0496118_0001856_10283_11446 363
46 3300048922 Ga0496119_0013837 Ga0496119_0013837_2711_3874 363
47 3300005844 Ga0068862_100111681 Ga0068862_1001116813 365
48 3300017792 Ga0163161_10040149 Ga0163161_100401493 365
49 3300025972 Ga0207668_10017028 Ga0207668_100170284 365
50 iso_pu_bacteria 2915358134 2915358496 365
51 3300031649 Ga0307514_10072196 Ga0307514_100721963 366
52 3300048905 Ga0496102_0001687 Ga0496102_0001687_6816_7949 366
53 iso_pu_bacteria 2811994878 2812352444 366
54 iso_pu_bacteria 2862507626 2862509747 366
55 3300044684 Ga0466966_0018666 Ga0466966_0018666_1669_2877 367
56 3300045049 Ga0466959_0188557 Ga0466959_0188557_218_1426 367
57 iso_pu_bacteria 2547132424 2548696096 367
58 iso_pu_bacteria 2585427649 2586063010 367
59 iso_pu_bacteria 2899359706 2899365739 367
60 3300049577 Ga0501041_0021890 Ga0501041_0021890_2512_3657 368
61 iso_pu_bacteria 2551306166 2552107937 369
62 3300031456 Ga0307513_10084282 Ga0307513_100842822 370
63 3300044684 Ga0466966_0000723 Ga0466966_0000723_15145_16362 370
64 3300044693 Ga0466961_0067296 Ga0466961_0067296_663_1880 370
65 3300044719 Ga0466971_0003626 Ga0466971_0003626_2439_3656 370
66 3300045049 Ga0466959_0003212 Ga0466959_0003212_4532_5749 370
67 3300045836 Ga0466958_0042597 Ga0466958_0042597_1249_2466 370
68 3300049568 Ga0501031_0035389 Ga0501031_0035389_156_1310 370
69 3300049569 Ga0501032_0000213 Ga0501032_0000213_5988_7142 370
70 3300049570 Ga0501033_0001058 Ga0501033_0001058_6008_7162 370
71 3300049571 Ga0501034_0000569 Ga0501034_0000569_40956_42110 370
72 3300049572 Ga0501036_0000562 Ga0501036_0000562_13820_14974 370
73 3300049573 Ga0501037_0000791 Ga0501037_0000791_16636_17790 370
74 3300049574 Ga0501038_0000124 Ga0501038_0000124_6006_7160 370
75 3300049575 Ga0501039_0000095 Ga0501039_0000095_21947_23101 370
76 3300049579 Ga0501043_0000331 Ga0501043_0000331_16374_17528 370
77 3300049822 Ga0501035_0000204 Ga0501035_0000204_17567_18721 370
78 3300061719 Ga0466962_0035310 Ga0466962_0035310_481_1698 370
79 3300005518 Ga0070699_100190074 Ga0070699_1001900741 371
80 3300005549 Ga0070704_100001854 Ga0070704_1000018547 371
81 3300025926 Ga0207659_10267101 Ga0207659_102671011 371
82 3300037853 Ga0436364_0218794 Ga0436364_0218794_227_1402 371
83 3300005467 Ga0070706_100020666 Ga0070706_1000206662 372
84 3300005468 Ga0070707_100155986 Ga0070707_1001559865 372
85 3300005471 Ga0070698_100190876 Ga0070698_1001908762 372
86 3300009148 Ga0105243_10008562 Ga0105243_100085627 372
87 3300013102 Ga0157371_10237636 Ga0157371_102376361 372
88 3300025922 Ga0207646_10121207 Ga0207646_101212075 372
89 3300037853 Ga0436364_1047218 Ga0436364_1047218_1302_2459 372
90 iso_pu_bacteria 2889914905 2889916897 372
91 iso_pu_bacteria 8056207758 8056210369 372
92 3300025914 Ga0207671_10147078 Ga0207671_101470783 373
93 iso_pu_bacteria 2643221603 2644029547 374
94 iso_pu_bacteria 2866552031 2866553876 374
95 3300005535 Ga0070684_100172982 Ga0070684_1001729822 375
96 3300013105 Ga0157369_10193303 Ga0157369_101933032 375
97 3300020082 Ga0206353_11981227 Ga0206353_119812272 375
98 3300025912 Ga0207707_10171875 Ga0207707_101718752 375
99 3300026067 Ga0207678_10021596 Ga0207678_100215962 375
100 3300049571 Ga0501034_0035271 Ga0501034_0035271_1149_2300 375
101 3300005435 Ga0070714_100057494 Ga0070714_1000574942 376
102 3300005468 Ga0070707_100139943 Ga0070707_1001399431 376
103 3300005937 Ga0081455_10000815 Ga0081455_100008152 376
104 3300049569 Ga0501032_0000013 Ga0501032_0000013_26026_27192 376
105 3300049570 Ga0501033_0000427 Ga0501033_0000427_13054_14220 376
106 3300049571 Ga0501034_0000054 Ga0501034_0000054_130408_131574 376
107 3300049572 Ga0501036_0000031 Ga0501036_0000031_50000_51166 376
108 3300049573 Ga0501037_0000096 Ga0501037_0000096_25239_26405 376
109 3300049574 Ga0501038_0000018 Ga0501038_0000018_82575_83741 376
110 3300049575 Ga0501039_0000018 Ga0501039_0000018_162499_163665 376
111 3300049579 Ga0501043_0000014 Ga0501043_0000014_78777_79943 376
112 3300049580 Ga0501046_0166094 Ga0501046_0166094_60_1226 376
113 3300049822 Ga0501035_0000019 Ga0501035_0000019_110827_111993 376
114 3300049823 Ga0501044_0003562 Ga0501044_0003562_5580_6746 376
115 iso_pu_bacteria 2917736166 2917744640 376
116 3300035083 Ga0373926_0002478 Ga0373926_0002478_590_1807 377
117 3300035725 Ga0373947_0000016 Ga0373947_0000016_68895_70112 377
118 3300044673 Ga0453683_0000588 Ga0453683_0000588_9791_10924 377
119 3300045051 Ga0451576_0001358 Ga0451576_0001358_2785_3918 377
120 iso_pu_bacteria 8054472261 8054474987 377
121 3300005458 Ga0070681_10024494 Ga0070681_100244945 378
122 3300005535 Ga0070684_100383412 Ga0070684_1003834121 378
123 3300013104 Ga0157370_10230720 Ga0157370_102307202 378
124 3300013105 Ga0157369_10002895 Ga0157369_1000289513 378
125 3300014497 Ga0182008_10021953 Ga0182008_100219534 378
126 3300025294 Ga0209025_1001275 Ga0209025_100127510 378
127 3300025913 Ga0207695_10107830 Ga0207695_101078302 378
128 3300031711 Ga0265314_10023752 Ga0265314_100237525 378
129 3300036401 Ga0373937_0005057 Ga0373937_0005057_7802_8956 378
130 3300037466 Ga0395898_0265241 Ga0395898_0265241_166_1320 378
131 3300045976 Ga0466967_0041578 Ga0466967_0041578_2027_3214 378
132 3300048918 Ga0496115_0070995 Ga0496115_0070995_921_2075 378
133 3300014497 Ga0182008_10019539 Ga0182008_100195393 379
134 3300025256 Ga0209759_1001559 Ga0209759_100155912 379
135 3300046472 Ga0495580_0048684 Ga0495580_0048684_1110_2288 379
136 3300002067 JGI24735J21928_10002413 JGI24735J21928_100024133 381
137 3300031548 Ga0307408_100000067 Ga0307408_100000067106 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

259

401

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6et9-assembly1.cif.gz_C structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.9301 8 381
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.9301 8 381
4u4e-assembly1.cif.gz_A crystal structure of putative thiolase from sphaerobacter thermophilus dsm 20745 0.9161 6 380
5ab7-assembly2.cif.gz_D crystal structure of trypanosoma brucei scp2-thiolase like protein (tbslp) in complex with malonyl-coa. 0.9157 8 381
5ab6-assembly3.cif.gz_C crystal structure of trypanosoma brucei scp2-thiolase like protein (tbslp) in complex with acetoacetyl-coa. 0.9151 8 378
ID Description Score Start End Superfamily
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9341 10 381 3.40.47.10
af_Q4D3C4_1_262_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9205 144 380 3.40.47.10
af_I6Y3T7_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9202 6 378 3.40.47.10
4u4eA00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9201 6 380 3.40.47.10
5ab7D00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9157 8 381 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A0U3QHX0-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9838 65 381 GO:0016020
GO:0016746
AF-A0A0U3QHX0-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9777 65 381 GO:0016020
GO:0016746
AF-A0A1F4B5B6-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9704 9 380 GO:0016747
AF-A0A3A0EK17-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9698 8 379 GO:0016747
AF-A0A536DP89-F1-model_v4 Thiolase 0.9684 154 378 GO:0016746

Feature Viewer

pLDDT pTM Quality
91.24 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map