F170345

General Info

Members Datasets Scaffolds Average Seq Length
137 99 137 106

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10085183|Ga0316579_100851833
Length 120
Sequence LGSAVRRGEVRWYTFRAPDKRRPVLILTRDSALSFLDSVTVAPITTTVRDIPSEVYLTPEDGPLAECAANMDNLQTVPKSRVGALITSLSAARMADVNRAIAFALGMDAQILWESEISLV

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
68 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
69 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
70 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
78 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
91 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
95 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
96 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
97 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 2.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 0.73
Rhizosphere 90.51
Stem 0
Stem Tuber 0
Unclassified 6.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10142893 3300003322 Unclassified 1828
2 Ga0065707_11152050 3300005295 Unclassified 504
3 Ga0070666_10548220 3300005335 Unclassified 841
4 Ga0070680_100055552 3300005336 Bacteria 3236
5 Ga0070659_100779745 3300005366 Unclassified 830
6 Ga0070709_10610398 3300005434 Bacteria 841
7 Ga0070714_101809132 3300005435 Bacteria 596
8 Ga0070708_100256633 3300005445 Bacteria 1643
9 Ga0070681_10001559 3300005458 Bacteria 20322
10 Ga0070681_10064840 3300005458 Bacteria 3623
11 Ga0070681_10112693 3300005458 Bacteria 2659
12 Ga0068867_101714099 3300005459 Unclassified 589
13 Ga0070698_100164063 3300005471 Bacteria 2165
14 Ga0070679_100025161 3300005530 Bacteria 5839
15 Ga0070679_100119278 3300005530 Bacteria 2623
16 Ga0070695_100005107 3300005545 Bacteria 7736
17 Ga0068856_100400490 3300005614 Bacteria 1392
18 Ga0068856_101545447 3300005614 Unclassified 677
19 Ga0068852_102406893 3300005616 Bacteria 547
20 Ga0068860_101805195 3300005843 Unclassified 633
21 Ga0070716_100124352 3300006173 Bacteria 1620
22 Ga0075431_100614685 3300006847 Bacteria 1070
23 Ga0075431_101544372 3300006847 Bacteria 622
24 Ga0075433_10173903 3300006852 Bacteria 1916
25 Ga0075429_100908358 3300006880 Bacteria 771
26 Ga0105240_10001215 3300009093 Bacteria 44901
27 Ga0105240_11136630 3300009093 Unclassified 830
28 Ga0105240_12084587 3300009093 Unclassified 589
29 Ga0111539_12923309 3300009094 Unclassified 553
30 Ga0105245_11196367 3300009098 Unclassified 808
31 Ga0105247_10453801 3300009101 Unclassified 925
32 Ga0105237_10177403 3300009545 Unclassified 2131
33 Ga0105237_10601648 3300009545 Unclassified 1107
34 Ga0105237_12027133 3300009545 Bacteria 584
35 Ga0105238_10056362 3300009551 Unclassified 3943
36 Ga0105238_10067915 3300009551 Bacteria 3565
37 Ga0105238_10310701 3300009551 Bacteria 1561
38 Ga0157370_10051597 3300013104 Bacteria 3929
39 Ga0157370_12019418 3300013104 Unclassified 517
40 Ga0157369_10149815 3300013105 Bacteria 2466
41 Ga0157372_10809522 3300013307 Unclassified 1088
42 Ga0157372_11189849 3300013307 Bacteria 881
43 Ga0157379_11066899 3300014968 Unclassified 773
44 Ga0213875_10025273 3300021388 Bacteria 2830
45 Ga0207692_10017517 3300025898 Bacteria 3198
46 Ga0207707_10063542 3300025912 Bacteria 3213
47 Ga0207707_10085024 3300025912 Bacteria 2764
48 Ga0207707_10089080 3300025912 Bacteria 2696
49 Ga0207695_10018472 3300025913 Bacteria 8064
50 Ga0207695_11179246 3300025913 Unclassified 646
51 Ga0207671_10494668 3300025914 Unclassified 975
52 Ga0207671_10577117 3300025914 Unclassified 896
53 Ga0207660_10105757 3300025917 Bacteria 2110
54 Ga0207660_10422211 3300025917 Bacteria 1076
55 Ga0207652_10015256 3300025921 Bacteria 6236
56 Ga0207652_10170180 3300025921 Bacteria 1955
57 Ga0207694_10781311 3300025924 Unclassified 806
58 Ga0207664_10849643 3300025929 Bacteria 820
59 Ga0207669_11886656 3300025937 Unclassified 511
60 Ga0207667_10396016 3300025949 Bacteria 1406
61 Ga0207702_11360894 3300026078 Bacteria 704
62 Ga0265338_10780557 3300028800 Unclassified 655
63 Ga0307511_10000259 3300030521 Bacteria 54621
64 Ga0307511_10047024 3300030521 Bacteria 3538
65 Ga0265762_1014721 3300030760 Bacteria 1412
66 Ga0265770_1157957 3300030878 Unclassified 502
67 Ga0265765_1010236 3300030879 Bacteria 1043
68 Ga0265325_10055955 3300031241 Bacteria 2016
69 Ga0265340_10040086 3300031247 Bacteria 2308
70 Ga0265331_10029911 3300031250 Unclassified 2715
71 Ga0265316_10042959 3300031344 Bacteria 3608
72 Ga0265316_10284813 3300031344 Bacteria 1207
73 Ga0307508_10003387 3300031616 Bacteria 16157
74 Ga0316579_10085183 3300031691 Bacteria 1508
75 Ga0265342_10380402 3300031712 Unclassified 731
76 Ga0316578_10415722 3300031728 Unclassified 796
77 Ga0316577_10002772 3300031733 Bacteria 8734
78 Ga0316577_10219681 3300031733 Bacteria 1074
79 Ga0316577_10682186 3300031733 Unclassified 584
80 Ga0307416_100854534 3300032002 Unclassified 1008
81 Ga0373923_0258024 3300035111 Unclassified 817
82 Ga0373933_0035065 3300035724 Bacteria 2928
83 Ga0373933_0576000 3300035724 Unclassified 739
84 Ga0373933_1159452 3300035724 Unclassified 509
85 Ga0373937_0011098 3300036401 Bacteria 7896
86 Ga0316582_0000393 3300036647 Bacteria 15855
87 Ga0316582_0183747 3300036647 Bacteria 1423
88 Ga0316582_0682614 3300036647 Bacteria 706
89 Ga0316584_0002371 3300036712 Bacteria 11895
90 Ga0316584_0578121 3300036712 Unclassified 781
91 Ga0395900_0109006 3300037418 Unclassified 2845
92 Ga0395898_0019849 3300037466 Bacteria 6836
93 Ga0395898_0125759 3300037466 Bacteria 2456
94 Ga0316581_0000303 3300037588 Bacteria 8794
95 Ga0436364_0236635 3300037853 Bacteria 5333
96 Ga0400484_03945 3300038725 Bacteria 4683
97 Ga0400490_31942 3300038726 Bacteria 1682
98 Ga0400488_60152 3300038741 Bacteria 1274
99 Ga0439435_0061489 3300042436 Bacteria 1095
100 Ga0466967_2382398 3300045976 Unclassified 525
101 Ga0495592_0884518 3300046454 Unclassified 526
102 Ga0495651_0349926 3300046462 Bacteria 977
103 Ga0495657_0158620 3300046675 Bacteria 1401
104 Ga0495623_0023113 3300046679 Bacteria 4013
105 Ga0495602_0035724 3300048088 Bacteria 4632
106 Ga0496112_0138678 3300048915 Bacteria 2402
107 Ga0501297_041369 3300049520 Unclassified 650
108 Ga0501297_047664 3300049520 Unclassified 622
109 Ga0501038_0027648 3300049574 Bacteria 5045
110 Ga0501039_0255181 3300049575 Unclassified 1379
111 Ga0501039_1413061 3300049575 Bacteria 536
112 Ga0501040_1345988 3300049576 Unclassified 518
113 Ga0501041_0278278 3300049577 Bacteria 1053
114 Ga0501071_0419364 3300049587 Unclassified 1023
115 Ga0501072_0485261 3300049588 Bacteria 978
116 Ga0501072_0880811 3300049588 Bacteria 700
117 Ga0501075_0306704 3300049591 Bacteria 1210
118 Ga0501075_0411542 3300049591 Bacteria 1031
119 Ga0501076_0687407 3300049592 Bacteria 845
120 Ga0501206_016056 3300049653 Bacteria 1040
121 Ga0501206_104485 3300049653 Unclassified 517
122 Ga0501079_0212231 3300049741 Bacteria 1512
123 Ga0501079_0503040 3300049741 Bacteria 953
124 Ga0501081_0410859 3300049743 Bacteria 1003
125 Ga0501081_0507872 3300049743 Bacteria 899
126 Ga0501081_0592680 3300049743 Bacteria 830
127 Ga0501212_020313 3300049851 Bacteria 1023
128 nmdc:mga09592_847951_c1 3300050508 Bacteria 771
129 nmdc:mga06r32_13032_c1 3300050510 Bacteria 7522
130 nmdc:mga08y16_1863008_c1 3300050511 Unclassified 553
131 nmdc:mga0a205_90959_c1 3300050515 Bacteria 2948
132 Ga0500555_016811 3300053103 Bacteria 2108
133 Ga0500616_0000042 3300053153 Bacteria 351293
134 Ga0500637_0140338 3300053178 Bacteria 1399
135 Ga0501084_0212630 3300054114 Bacteria 1632
136 Ga0501084_1454036 3300054114 Bacteria 574
137 Ga0530510_0312304 3300061734 Bacteria 1177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006173 Ga0070716_100124352 Ga0070716_1001243522 88
2 3300005458 Ga0070681_10064840 Ga0070681_100648402 94
3 3300025912 Ga0207707_10085024 Ga0207707_100850244 94
4 3300048915 Ga0496112_0138678 Ga0496112_0138678_1047_1373 94
5 3300049520 Ga0501297_047664 Ga0501297_047664_13_297 94
6 3300035724 Ga0373933_1159452 Ga0373933_1159452_25_330 98
7 3300025937 Ga0207669_11886656 Ga0207669_118866561 101
8 3300049588 Ga0501072_0880811 Ga0501072_0880811_79_396 101
9 3300049592 Ga0501076_0687407 Ga0501076_0687407_144_461 101
10 3300049741 Ga0501079_0503040 Ga0501079_0503040_94_411 101
11 3300061734 Ga0530510_0312304 Ga0530510_0312304_186_503 101
12 3300003322 rootL2_10142893 rootL2_101428931 103
13 3300005295 Ga0065707_11152050 Ga0065707_111520501 103
14 3300005335 Ga0070666_10548220 Ga0070666_105482202 103
15 3300005336 Ga0070680_100055552 Ga0070680_1000555523 103
16 3300005366 Ga0070659_100779745 Ga0070659_1007797452 103
17 3300005434 Ga0070709_10610398 Ga0070709_106103982 103
18 3300005435 Ga0070714_101809132 Ga0070714_1018091321 103
19 3300005445 Ga0070708_100256633 Ga0070708_1002566332 103
20 3300005458 Ga0070681_10001559 Ga0070681_1000155920 103
21 3300005458 Ga0070681_10112693 Ga0070681_101126932 103
22 3300005459 Ga0068867_101714099 Ga0068867_1017140991 103
23 3300005471 Ga0070698_100164063 Ga0070698_1001640632 103
24 3300005530 Ga0070679_100025161 Ga0070679_1000251615 103
25 3300005530 Ga0070679_100119278 Ga0070679_1001192783 103
26 3300005545 Ga0070695_100005107 Ga0070695_1000051074 103
27 3300005614 Ga0068856_100400490 Ga0068856_1004004902 103
28 3300005614 Ga0068856_101545447 Ga0068856_1015454471 103
29 3300005616 Ga0068852_102406893 Ga0068852_1024068931 103
30 3300005843 Ga0068860_101805195 Ga0068860_1018051951 103
31 3300006847 Ga0075431_100614685 Ga0075431_1006146852 103
32 3300006847 Ga0075431_101544372 Ga0075431_1015443722 103
33 3300006852 Ga0075433_10173903 Ga0075433_101739032 103
34 3300006880 Ga0075429_100908358 Ga0075429_1009083582 103
35 3300009093 Ga0105240_10001215 Ga0105240_1000121521 103
36 3300009093 Ga0105240_11136630 Ga0105240_111366301 103
37 3300009093 Ga0105240_12084587 Ga0105240_120845871 103
38 3300009094 Ga0111539_12923309 Ga0111539_129233091 103
39 3300009098 Ga0105245_11196367 Ga0105245_111963672 103
40 3300009101 Ga0105247_10453801 Ga0105247_104538012 103
41 3300009545 Ga0105237_10177403 Ga0105237_101774033 103
42 3300009545 Ga0105237_10601648 Ga0105237_106016482 103
43 3300009545 Ga0105237_12027133 Ga0105237_120271331 103
44 3300009551 Ga0105238_10056362 Ga0105238_100563625 103
45 3300009551 Ga0105238_10067915 Ga0105238_100679154 103
46 3300009551 Ga0105238_10310701 Ga0105238_103107012 103
47 3300013104 Ga0157370_10051597 Ga0157370_100515975 103
48 3300013104 Ga0157370_12019418 Ga0157370_120194181 103
49 3300013105 Ga0157369_10149815 Ga0157369_101498155 103
50 3300013307 Ga0157372_10809522 Ga0157372_108095223 103
51 3300013307 Ga0157372_11189849 Ga0157372_111898492 103
52 3300014968 Ga0157379_11066899 Ga0157379_110668991 103
53 3300021388 Ga0213875_10025273 Ga0213875_100252733 103
54 3300025898 Ga0207692_10017517 Ga0207692_100175172 103
55 3300025912 Ga0207707_10063542 Ga0207707_100635427 103
56 3300025912 Ga0207707_10089080 Ga0207707_100890803 103
57 3300025913 Ga0207695_10018472 Ga0207695_1001847211 103
58 3300025913 Ga0207695_11179246 Ga0207695_111792461 103
59 3300025914 Ga0207671_10494668 Ga0207671_104946682 103
60 3300025914 Ga0207671_10577117 Ga0207671_105771172 103
61 3300025917 Ga0207660_10105757 Ga0207660_101057574 103
62 3300025917 Ga0207660_10422211 Ga0207660_104222112 103
63 3300025921 Ga0207652_10015256 Ga0207652_100152563 103
64 3300025921 Ga0207652_10170180 Ga0207652_101701802 103
65 3300025924 Ga0207694_10781311 Ga0207694_107813112 103
66 3300025929 Ga0207664_10849643 Ga0207664_108496431 103
67 3300025949 Ga0207667_10396016 Ga0207667_103960162 103
68 3300026078 Ga0207702_11360894 Ga0207702_113608941 103
69 3300028800 Ga0265338_10780557 Ga0265338_107805571 103
70 3300030521 Ga0307511_10000259 Ga0307511_1000025935 103
71 3300030521 Ga0307511_10047024 Ga0307511_100470245 103
72 3300030760 Ga0265762_1014721 Ga0265762_10147212 103
73 3300030878 Ga0265770_1157957 Ga0265770_11579572 103
74 3300030879 Ga0265765_1010236 Ga0265765_10102361 103
75 3300031241 Ga0265325_10055955 Ga0265325_100559553 103
76 3300031247 Ga0265340_10040086 Ga0265340_100400863 103
77 3300031250 Ga0265331_10029911 Ga0265331_100299112 103
78 3300031344 Ga0265316_10042959 Ga0265316_100429594 103
79 3300031344 Ga0265316_10284813 Ga0265316_102848133 103
80 3300031616 Ga0307508_10003387 Ga0307508_1000338711 103
81 3300031691 Ga0316579_10085183 Ga0316579_100851833 103
82 3300031712 Ga0265342_10380402 Ga0265342_103804022 103
83 3300031728 Ga0316578_10415722 Ga0316578_104157222 103
84 3300031733 Ga0316577_10002772 Ga0316577_100027725 103
85 3300031733 Ga0316577_10219681 Ga0316577_102196812 103
86 3300031733 Ga0316577_10682186 Ga0316577_106821862 103
87 3300032002 Ga0307416_100854534 Ga0307416_1008545343 103
88 3300035111 Ga0373923_0258024 Ga0373923_0258024_66_386 103
89 3300035724 Ga0373933_0035065 Ga0373933_0035065_652_972 103
90 3300035724 Ga0373933_0576000 Ga0373933_0576000_41_364 103
91 3300036401 Ga0373937_0011098 Ga0373937_0011098_4220_4540 103
92 3300036647 Ga0316582_0000393 Ga0316582_0000393_7382_7714 103
93 3300036647 Ga0316582_0183747 Ga0316582_0183747_1072_1404 103
94 3300036647 Ga0316582_0682614 Ga0316582_0682614_209_544 103
95 3300036712 Ga0316584_0002371 Ga0316584_0002371_6542_6874 103
96 3300036712 Ga0316584_0578121 Ga0316584_0578121_316_648 103
97 3300037418 Ga0395900_0109006 Ga0395900_0109006_499_819 103
98 3300037466 Ga0395898_0019849 Ga0395898_0019849_4738_5058 103
99 3300037466 Ga0395898_0125759 Ga0395898_0125759_435_755 103
100 3300037588 Ga0316581_0000303 Ga0316581_0000303_616_948 103
101 3300037853 Ga0436364_0236635 Ga0436364_0236635_1597_1920 103
102 3300038725 Ga0400484_03945 Ga0400484_03945_2816_3151 103
103 3300038726 Ga0400490_31942 Ga0400490_31942_607_942 103
104 3300038741 Ga0400488_60152 Ga0400488_60152_807_1142 103
105 3300042436 Ga0439435_0061489 Ga0439435_0061489_290_601 103
106 3300045976 Ga0466967_2382398 Ga0466967_2382398_153_479 103
107 3300046454 Ga0495592_0884518 Ga0495592_0884518_77_397 103
108 3300046462 Ga0495651_0349926 Ga0495651_0349926_136_456 103
109 3300046675 Ga0495657_0158620 Ga0495657_0158620_551_871 103
110 3300046679 Ga0495623_0023113 Ga0495623_0023113_3572_3892 103
111 3300048088 Ga0495602_0035724 Ga0495602_0035724_552_872 103
112 3300049520 Ga0501297_041369 Ga0501297_041369_317_631 103
113 3300049574 Ga0501038_0027648 Ga0501038_0027648_4197_4523 103
114 3300049575 Ga0501039_0255181 Ga0501039_0255181_488_799 103
115 3300049575 Ga0501039_1413061 Ga0501039_1413061_183_494 103
116 3300049576 Ga0501040_1345988 Ga0501040_1345988_176_487 103
117 3300049577 Ga0501041_0278278 Ga0501041_0278278_577_888 103
118 3300049587 Ga0501071_0419364 Ga0501071_0419364_601_912 103
119 3300049588 Ga0501072_0485261 Ga0501072_0485261_448_759 103
120 3300049591 Ga0501075_0306704 Ga0501075_0306704_449_760 103
121 3300049591 Ga0501075_0411542 Ga0501075_0411542_485_796 103
122 3300049653 Ga0501206_016056 Ga0501206_016056_597_920 103
123 3300049653 Ga0501206_104485 Ga0501206_104485_157_468 103
124 3300049741 Ga0501079_0212231 Ga0501079_0212231_1182_1493 103
125 3300049743 Ga0501081_0410859 Ga0501081_0410859_535_846 103
126 3300049743 Ga0501081_0507872 Ga0501081_0507872_203_514 103
127 3300049743 Ga0501081_0592680 Ga0501081_0592680_91_402 103
128 3300049851 Ga0501212_020313 Ga0501212_020313_298_621 103
129 3300050508 nmdc:mga09592_847951_c1 nmdc:mga09592_847951_c1_290_601 103
130 3300050510 nmdc:mga06r32_13032_c1 nmdc:mga06r32_13032_c1_6685_6996 103
131 3300050511 nmdc:mga08y16_1863008_c1 nmdc:mga08y16_1863008_c1_60_383 103
132 3300050515 nmdc:mga0a205_90959_c1 nmdc:mga0a205_90959_c1_1287_1610 103
133 3300053103 Ga0500555_016811 Ga0500555_016811_144_470 103
134 3300053153 Ga0500616_0000042 Ga0500616_0000042_237909_238229 103
135 3300053178 Ga0500637_0140338 Ga0500637_0140338_1064_1384 103
136 3300054114 Ga0501084_0212630 Ga0501084_0212630_450_776 103
137 3300054114 Ga0501084_1454036 Ga0501084_1454036_84_413 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

6

105

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uct-assembly1.cif.gz_A-2 mycobacterium tuberculosis toxin mazf-mt6 0.954 5 103
5xe3-assembly1.cif.gz_A endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.947 1 103
5xe2-assembly1.cif.gz_A-2 endoribonuclease from mycobacterial species 0.9385 1 103
5hk0-assembly1.cif.gz_A crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9344 1 103
4me7-assembly1.cif.gz_B crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze 0.9335 1 102
ID Description Score Start End Superfamily
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9545 3 102 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9482 1 103 2.30.30.110
af_P9WII1_5_102_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9294 5 103 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9275 3 102 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.9229 1 102 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A6H9L1J9-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9995 1 102 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A2V9QB91-F1-model_v4 PemK family transcriptional regulator 0.9981 1 102 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A2H0AQH0-F1-model_v4 PemK family transcriptional regulator 0.9972 33 102 GO:0003677
AF-A0A2H0ATN2-F1-model_v4 PemK family transcriptional regulator 0.9957 41 102 GO:0003677
AF-A0A7W0QCX4-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.995 36 103 GO:0003677

Feature Viewer

pLDDT pTM Quality
91.87 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map