F170267

General Info

Members Datasets Scaffolds Average Seq Length
137 110 133 575

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10112245|Ga0265338_101122452
Length 633
Sequence MSRKVIVLKFGSSVLHSREELPHAVHEIYRWIRRQYRVVAVVSAFAGETDRLLSTVADYRDACPEAIARVVATGEEVATAFLALELDRFGIPAQVLDPSQIRLIAETTSNDTEPVSADILAIENVFKLGRVAVIPGFVARDRLGRVALFGRGGSDLSALFLAKQLDARCRLIKDVDGIYDSDPATCYDAKRFDEINFSDALAIGGKIVQQKAITFGRKTGVPFEVAALGEDYATAVGSHRSVLATRSSSAAPLKVGLLGLGTVGLGVFQELAKHPDLFEVAGIAVRRPDLHTDHAPGSLLTRNCWDAIGDVDVVVELIGGTEPAGDLVKAALAAGKPVVTANKLLLAQDAQLGGHRSLRYSAAVGGAVPALEAVGALADDGRIVSLSGVLNGTCNYILDRLAAGCSWTQAIAEAQAHGFAEADPRADLSGSDTVCKLRLLARRAFPDFDAHTISATGIDAIDPEWVQSAARDGGCARLVGTAQLVDGRVHLDVKPTLVDSLHPFAQIRNEENCLLIDTGHSDSQQLWIGRGAGRWPTTAAVMADLFDLSRELRATSPEXXXASASCQGPTSVGPDTARLDEGFSPCTVEWSQGLKAGSPATPAARLKPCPDTNRSSELTADHWPLATAFGGAA

Samples

Sample ID Description Type Environment
1 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
2 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
3 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
4 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 2.92
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0.73
Rhizoplane 0.73
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1027214 3300003578 Bacteria 13070
2 Ga0006562J51391_1027215 3300003578 Bacteria 9330
3 Ga0055536_1000290 3300003781 Bacteria 37915
4 Ga0065704_10078894 3300005289 Bacteria 4300
5 Ga0065715_10095221 3300005293 Bacteria 4136
6 Ga0065707_10001402 3300005295 Bacteria 21742
7 Ga0068869_100013984 3300005334 Bacteria 5352
8 Ga0070660_100033755 3300005339 Unclassified 3860
9 Ga0070692_10014967 3300005345 Unclassified 3658
10 Ga0070669_100037386 3300005353 Bacteria 3521
11 Ga0070671_100033802 3300005355 Unclassified 4231
12 Ga0070714_100072117 3300005435 Bacteria 2989
13 Ga0070694_100000925 3300005444 Bacteria 16588
14 Ga0070694_100060660 3300005444 Unclassified 2580
15 Ga0070681_10060965 3300005458 Bacteria 3748
16 Ga0070681_10073991 3300005458 Unclassified 3368
17 Ga0068867_100022439 3300005459 Bacteria 4514
18 Ga0070706_100000211 3300005467 Bacteria 71647
19 Ga0070706_100001057 3300005467 Bacteria 29881
20 Ga0070706_100003157 3300005467 Bacteria 16282
21 Ga0070706_100079073 3300005467 Bacteria 3044
22 Ga0070707_100000109 3300005468 Bacteria 75892
23 Ga0070679_100099467 3300005530 Unclassified 2896
24 Ga0070697_100045168 3300005536 Unclassified 3570
25 Ga0070697_100130656 3300005536 Bacteria 2106
26 Ga0068853_100047390 3300005539 Unclassified 3688
27 Ga0070695_100036418 3300005545 Bacteria 3097
28 Ga0070696_100005723 3300005546 Bacteria 8297
29 Ga0070664_100010353 3300005564 Bacteria 7565
30 Ga0068857_100023261 3300005577 Bacteria 5453
31 Ga0070702_100060407 3300005615 Bacteria 2204
32 Ga0068859_100034137 3300005617 Bacteria 5107
33 Ga0068864_100019167 3300005618 Bacteria 5719
34 Ga0068861_100003126 3300005719 Bacteria 10939
35 Ga0068863_100053068 3300005841 Bacteria 3842
36 Ga0068863_100068643 3300005841 Bacteria 3353
37 Ga0068858_100012394 3300005842 Bacteria 8039
38 Ga0068860_100002252 3300005843 Bacteria 20291
39 Ga0068860_100058951 3300005843 Bacteria 3650
40 Ga0068862_100087936 3300005844 Unclassified 2703
41 Ga0068862_100135521 3300005844 Unclassified 2182
42 Ga0081539_10004415 3300005985 Bacteria 15570
43 Ga0097621_100002456 3300006237 Bacteria 12688
44 Ga0097621_100083824 3300006237 Bacteria 2657
45 Ga0068871_100001154 3300006358 Bacteria 17729
46 Ga0075430_100032720 3300006846 Bacteria 4413
47 Ga0075434_100041048 3300006871 Unclassified 4582
48 Ga0075429_100008855 3300006880 Bacteria 8748
49 Ga0097620_100034136 3300006931 Bacteria 5107
50 Ga0099826_10052890 3300006948 Bacteria 2708
51 Ga0111539_10000363 3300009094 Bacteria 55793
52 Ga0105247_10043850 3300009101 Bacteria 2741
53 Ga0114129_10020138 3300009147 Bacteria 9494
54 Ga0114129_10132582 3300009147 Bacteria 3421
55 Ga0105243_10018882 3300009148 Bacteria 5227
56 Ga0105248_10125256 3300009177 Bacteria 2898
57 Ga0105238_10006008 3300009551 Bacteria 12032
58 Ga0105238_10008897 3300009551 Bacteria 10050
59 Ga0157370_10013545 3300013104 Bacteria 8393
60 Ga0157369_10063034 3300013105 Bacteria 3994
61 Ga0157372_10029397 3300013307 Bacteria 6000
62 Ga0157372_10080496 3300013307 Unclassified 3685
63 Ga0157372_10245854 3300013307 Unclassified 2076
64 Ga0163163_10018858 3300014325 Bacteria 6471
65 Ga0163163_10069233 3300014325 Bacteria 3513
66 Ga0157380_10000562 3300014326 Bacteria 22814
67 Ga0157377_10054801 3300014745 Bacteria 2259
68 Ga0157379_10027281 3300014968 Bacteria 5084
69 Ga0213872_10004967 3300021361 Bacteria 6918
70 Ga0209676_1000182 3300025292 Bacteria 146373
71 Ga0209676_1001439 3300025292 Bacteria 22421
72 Ga0209050_1008311 3300025298 Bacteria 5580
73 Ga0209257_1000484 3300025304 Bacteria 72044
74 Ga0207647_10004707 3300025904 Bacteria 10104
75 Ga0207684_10000450 3300025910 Bacteria 54199
76 Ga0207684_10002921 3300025910 Bacteria 16940
77 Ga0207707_10033389 3300025912 Bacteria 4503
78 Ga0207707_10035679 3300025912 Unclassified 4348
79 Ga0207695_10028677 3300025913 Bacteria 6163
80 Ga0207657_10036795 3300025919 Unclassified 4379
81 Ga0207646_10000445 3300025922 Bacteria 55392
82 Ga0207694_10010492 3300025924 Bacteria 6988
83 Ga0207694_10038332 3300025924 Bacteria 3685
84 Ga0207650_10068775 3300025925 Bacteria 2660
85 Ga0207644_10025567 3300025931 Unclassified 4060
86 Ga0207689_10078600 3300025942 Unclassified 2711
87 Ga0207639_10036174 3300026041 Unclassified 3658
88 Ga0207641_10094350 3300026088 Bacteria 2624
89 Ga0207648_10014116 3300026089 Bacteria 7388
90 Ga0207648_10066665 3300026089 Unclassified 3139
91 Ga0207676_10023306 3300026095 Bacteria 4565
92 Ga0207674_10004142 3300026116 Bacteria 17543
93 Ga0207674_10068692 3300026116 Bacteria 3565
94 Ga0207675_100006652 3300026118 Bacteria 10936
95 Ga0207675_100020756 3300026118 Bacteria 6124
96 Ga0207428_10008219 3300027907 Bacteria 9436
97 Ga0268264_10044215 3300028381 Bacteria 3694
98 Ga0265338_10112245 3300028800 Bacteria 2192
99 Ga0265760_10002016 3300031090 Bacteria 5976
100 Ga0265760_10006425 3300031090 Bacteria 3362
101 Ga0265340_10030758 3300031247 Bacteria 2689
102 Ga0265316_10084001 3300031344 Bacteria 2439
103 Ga0307509_10003159 3300031507 Bacteria 25515
104 Ga0265313_10022704 3300031595 Bacteria 3397
105 Ga0316575_10008681 3300031665 Bacteria 3706
106 Ga0307406_10000305 3300031901 Bacteria 28688
107 Ga0307412_10017368 3300031911 Bacteria 4306
108 Ga0307414_10015361 3300032004 Bacteria 4621
109 Ga0307414_10023101 3300032004 Bacteria 3936
110 Ga0395899_0000004 3300037312 Bacteria 874267
111 Ga0436365_0840146 3300039437 Bacteria 3459
112 Ga0436361_0148204 3300039447 Bacteria 7568
113 Ga0495638_0030396 3300046460 Bacteria 3478
114 Ga0495633_0000752 3300046558 Bacteria 29244
115 Ga0495625_0001867 3300046660 Bacteria 23949
116 Ga0495649_0000134 3300046694 Bacteria 64953
117 Ga0496102_0107261 3300048905 Bacteria 2601
118 Ga0496121_0103231 3300048924 Bacteria 2194
119 Ga0496122_0004127 3300048925 Bacteria 18367
120 Ga0496123_0001649 3300048926 Bacteria 29965
121 Ga0496125_0000174 3300048928 Bacteria 144548
122 Ga0501046_0080180 3300049580 Bacteria 2523
123 Ga0501249_003826 3300049679 Unclassified 3036
124 nmdc:mga05p37_9501_c1 3300050507 Bacteria 11512
125 nmdc:mga0qj67_38918_c1 3300050509 Bacteria 3732
126 nmdc:mga08y16_183996_c1 3300050511 Bacteria 2168
127 nmdc:mga08y16_2462_c1 3300050511 Bacteria 19005
128 nmdc:mga0n895_5175_c1 3300050512 Bacteria 10855
129 nmdc:mga0a205_2043_c1 3300050515 Bacteria 17631
130 Ga0500644_0001774 3300053088 Bacteria 5585
131 Ga0500588_0011662 3300053146 Bacteria 2158
132 Ga0500622_0003802 3300053156 Bacteria 9829
133 Ga0500622_0004236 3300053156 Bacteria 9132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10095221 Ga0065715_100952212 471
2 3300006880 Ga0075429_100008855 Ga0075429_1000088552 489
3 3300005841 Ga0068863_100068643 Ga0068863_1000686432 493
4 3300026088 Ga0207641_10094350 Ga0207641_100943502 493
5 3300053156 Ga0500622_0004236 Ga0500622_0004236_316_2064 493
6 3300025925 Ga0207650_10068775 Ga0207650_100687752 506
7 3300014326 Ga0157380_10000562 Ga0157380_1000056217 511
8 3300005617 Ga0068859_100034137 Ga0068859_1000341374 514
9 3300006931 Ga0097620_100034136 Ga0097620_1000341362 514
10 3300005458 Ga0070681_10060965 Ga0070681_100609653 515
11 3300005545 Ga0070695_100036418 Ga0070695_1000364182 515
12 3300025912 Ga0207707_10033389 Ga0207707_100333893 515
13 3300028800 Ga0265338_10112245 Ga0265338_101122452 518
14 3300031090 Ga0265760_10006425 Ga0265760_100064252 518
15 3300031247 Ga0265340_10030758 Ga0265340_100307582 518
16 3300031344 Ga0265316_10084001 Ga0265316_100840012 518
17 3300031595 Ga0265313_10022704 Ga0265313_100227041 518
18 3300031911 Ga0307412_10017368 Ga0307412_100173683 520
19 3300053156 Ga0500622_0003802 Ga0500622_0003802_2101_3849 520
20 3300005615 Ga0070702_100060407 Ga0070702_1000604072 521
21 3300005841 Ga0068863_100053068 Ga0068863_1000530682 521
22 3300006237 Ga0097621_100083824 Ga0097621_1000838242 521
23 3300009101 Ga0105247_10043850 Ga0105247_100438502 521
24 3300026116 Ga0207674_10068692 Ga0207674_100686922 521
25 3300046660 Ga0495625_0001867 Ga0495625_0001867_3512_5194 521
26 3300048924 Ga0496121_0103231 Ga0496121_0103231_219_1901 521
27 3300031507 Ga0307509_10003159 Ga0307509_1000315917 522
28 3300005435 Ga0070714_100072117 Ga0070714_1000721172 523
29 3300013307 Ga0157372_10080496 Ga0157372_100804963 523
30 3300025904 Ga0207647_10004707 Ga0207647_100047073 523
31 3300005334 Ga0068869_100013984 Ga0068869_1000139842 524
32 3300005843 Ga0068860_100002252 Ga0068860_1000022527 524
33 3300005844 Ga0068862_100135521 Ga0068862_1001355212 524
34 3300006237 Ga0097621_100002456 Ga0097621_1000024563 524
35 3300006358 Ga0068871_100001154 Ga0068871_1000011542 524
36 3300009551 Ga0105238_10006008 Ga0105238_100060086 524
37 3300025924 Ga0207694_10038332 Ga0207694_100383322 524
38 3300005345 Ga0070692_10014967 Ga0070692_100149672 525
39 3300005444 Ga0070694_100060660 Ga0070694_1000606602 525
40 3300006948 Ga0099826_10052890 Ga0099826_100528903 525
41 3300013307 Ga0157372_10029397 Ga0157372_100293972 525
42 3300025913 Ga0207695_10028677 Ga0207695_100286773 525
43 3300049679 Ga0501249_003826 Ga0501249_003826_1255_2973 525
44 3300050511 nmdc:mga08y16_183996_c1 nmdc:mga08y16_183996_c1_165_1883 525
45 3300031090 Ga0265760_10002016 Ga0265760_100020166 526
46 3300005289 Ga0065704_10078894 Ga0065704_100788943 528
47 3300005295 Ga0065707_10001402 Ga0065707_100014022 528
48 3300005459 Ga0068867_100022439 Ga0068867_1000224393 528
49 3300006846 Ga0075430_100032720 Ga0075430_1000327203 528
50 3300009094 Ga0111539_10000363 Ga0111539_100003635 528
51 3300009148 Ga0105243_10018882 Ga0105243_100188823 528
52 3300026089 Ga0207648_10014116 Ga0207648_100141164 528
53 3300027907 Ga0207428_10008219 Ga0207428_100082197 528
54 3300050509 nmdc:mga0qj67_38918_c1 nmdc:mga0qj67_38918_c1_1748_3457 528
55 3300050511 nmdc:mga08y16_2462_c1 nmdc:mga08y16_2462_c1_15878_17605 528
56 3300005339 Ga0070660_100033755 Ga0070660_1000337552 529
57 3300005355 Ga0070671_100033802 Ga0070671_1000338023 529
58 3300005444 Ga0070694_100000925 Ga0070694_1000009254 529
59 3300005458 Ga0070681_10073991 Ga0070681_100739912 529
60 3300005468 Ga0070707_100000109 Ga0070707_10000010923 529
61 3300005530 Ga0070679_100099467 Ga0070679_1000994672 529
62 3300005539 Ga0068853_100047390 Ga0068853_1000473902 529
63 3300005546 Ga0070696_100005723 Ga0070696_1000057236 529
64 3300005564 Ga0070664_100010353 Ga0070664_1000103536 529
65 3300005577 Ga0068857_100023261 Ga0068857_1000232614 529
66 3300005985 Ga0081539_10004415 Ga0081539_100044159 529
67 3300013307 Ga0157372_10245854 Ga0157372_102458542 529
68 3300014325 Ga0163163_10018858 Ga0163163_100188582 529
69 3300014325 Ga0163163_10069233 Ga0163163_100692333 529
70 3300014968 Ga0157379_10027281 Ga0157379_100272813 529
71 3300025912 Ga0207707_10035679 Ga0207707_100356792 529
72 3300025919 Ga0207657_10036795 Ga0207657_100367954 529
73 3300025922 Ga0207646_10000445 Ga0207646_1000044523 529
74 3300025931 Ga0207644_10025567 Ga0207644_100255672 529
75 3300026041 Ga0207639_10036174 Ga0207639_100361742 529
76 3300026116 Ga0207674_10004142 Ga0207674_1000414212 529
77 3300005353 Ga0070669_100037386 Ga0070669_1000373863 530
78 3300005467 Ga0070706_100000211 Ga0070706_10000021118 530
79 3300005467 Ga0070706_100003157 Ga0070706_10000315710 530
80 3300005467 Ga0070706_100079073 Ga0070706_1000790732 530
81 3300005536 Ga0070697_100130656 Ga0070697_1001306562 530
82 3300005618 Ga0068864_100019167 Ga0068864_1000191675 530
83 3300005719 Ga0068861_100003126 Ga0068861_1000031262 530
84 3300005842 Ga0068858_100012394 Ga0068858_1000123942 530
85 3300005843 Ga0068860_100058951 Ga0068860_1000589512 530
86 3300005844 Ga0068862_100087936 Ga0068862_1000879362 530
87 3300006871 Ga0075434_100041048 Ga0075434_1000410482 530
88 3300009147 Ga0114129_10020138 Ga0114129_100201387 530
89 3300009177 Ga0105248_10125256 Ga0105248_101252562 530
90 3300009551 Ga0105238_10008897 Ga0105238_100088975 530
91 3300014745 Ga0157377_10054801 Ga0157377_100548012 530
92 3300025910 Ga0207684_10000450 Ga0207684_100004509 530
93 3300025910 Ga0207684_10002921 Ga0207684_1000292112 530
94 3300025924 Ga0207694_10010492 Ga0207694_100104922 530
95 3300026089 Ga0207648_10066665 Ga0207648_100666652 530
96 3300026095 Ga0207676_10023306 Ga0207676_100233063 530
97 3300026118 Ga0207675_100006652 Ga0207675_1000066522 530
98 3300026118 Ga0207675_100020756 Ga0207675_1000207565 530
99 3300028381 Ga0268264_10044215 Ga0268264_100442153 530
100 3300048905 Ga0496102_0107261 Ga0496102_0107261_565_2295 530
101 3300050507 nmdc:mga05p37_9501_c1 nmdc:mga05p37_9501_c1_9387_11126 530
102 3300050512 nmdc:mga0n895_5175_c1 nmdc:mga0n895_5175_c1_8998_10728 530
103 3300050515 nmdc:mga0a205_2043_c1 nmdc:mga0a205_2043_c1_2853_4583 530
104 3300025942 Ga0207689_10078600 Ga0207689_100786002 531
105 3300053146 Ga0500588_0011662 Ga0500588_0011662_258_2120 531
106 3300031665 Ga0316575_10008681 Ga0316575_100086812 539
107 iso_pu_bacteria 2643221663 2644353872 539
108 3300009147 Ga0114129_10132582 Ga0114129_101325822 540
109 3300039437 Ga0436365_0840146 Ga0436365_0840146_273_2006 540
110 iso_pu_bacteria 2941485952 2941488975 542
111 3300025292 Ga0209676_1001439 Ga0209676_100143915 543
112 3300003781 Ga0055536_1000290 Ga0055536_100029027 544
113 3300021361 Ga0213872_10004967 Ga0213872_100049676 544
114 3300025292 Ga0209676_1000182 Ga0209676_100018243 544
115 3300025298 Ga0209050_1008311 Ga0209050_10083113 544
116 3300025304 Ga0209257_1000484 Ga0209257_100048444 544
117 3300031901 Ga0307406_10000305 Ga0307406_100003052 544
118 3300032004 Ga0307414_10023101 Ga0307414_100231013 544
119 3300037312 Ga0395899_0000004 Ga0395899_0000004_226286_228037 544
120 3300039447 Ga0436361_0148204 Ga0436361_0148204_2932_4680 544
121 3300049580 Ga0501046_0080180 Ga0501046_0080180_651_2513 545
122 iso_pu_bacteria 2928972540 2928973108 545
123 iso_pu_bacteria 2977240413 2977242886 545
124 3300048928 Ga0496125_0000174 Ga0496125_0000174_98117_99850 546
125 3300053088 Ga0500644_0001774 Ga0500644_0001774_3241_4998 546
126 3300005467 Ga0070706_100001057 Ga0070706_1000010572 547
127 3300005536 Ga0070697_100045168 Ga0070697_1000451682 547
128 3300046460 Ga0495638_0030396 Ga0495638_0030396_1719_3464 548
129 3300046694 Ga0495649_0000134 Ga0495649_0000134_28868_30613 548
130 3300003578 Ga0006562J51391_1027214 Ga0006562J51391_10272149 549
131 3300003578 Ga0006562J51391_1027215 Ga0006562J51391_10272153 549
132 3300013104 Ga0157370_10013545 Ga0157370_100135459 549
133 3300013105 Ga0157369_10063034 Ga0157369_100630344 549
134 3300032004 Ga0307414_10015361 Ga0307414_100153615 549
135 3300046558 Ga0495633_0000752 Ga0495633_0000752_12389_14125 549
136 3300048925 Ga0496122_0004127 Ga0496122_0004127_12682_14418 549
137 3300048926 Ga0496123_0001649 Ga0496123_0001649_5920_7656 549

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00742

Homoserine_dh

Homoserine dehydrogenase

369

546

0.94

PF00696

AA_kinase

Amino acid kinase family

4

230

0.92

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

259

367

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yei-assembly2.cif.gz_E mechanistic insight into the regulation of pseudomonas aeruginosa aspartate kinase 0.9269 24 258
3ab4-assembly1.cif.gz_C crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.906 24 260
3ab2-assembly3.cif.gz_K crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.8982 24 261
3ab4-assembly2.cif.gz_G crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.8965 24 258
3ab4-assembly3.cif.gz_I crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.8953 24 260
ID Description Score Start End Superfamily
5yeiE01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9275 24 261 3.40.1160.10
af_Q2FYP1_2_256_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9239 23 261 3.40.1160.10
5yeiE01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9093 24 261 3.40.1160.10
3ab4G01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8885 24 261 3.40.1160.10
3ab4G01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8803 24 261 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A539CZU9-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9922 28 187 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A539CZU9-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9681 28 187 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A354VGS1-F1-model_v4 deleted 0.9497 23 199
AF-A0A2D6BL04-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9485 21 545 GO:0004412
GO:0009086
GO:0009088
GO:0050661
AF-A0A7X9PPT2-F1-model_v4 Aspartokinase (EC 2.7.2.4) 0.9456 23 262 GO:0004072
GO:0005524
GO:0005829
GO:0009088
GO:0009089
GO:0009090

Feature Viewer

pLDDT pTM Quality
89.9 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map