F169779

General Info

Members Datasets Scaffolds Average Seq Length
137 103 274 316

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10062298|Ga0157370_100622983
Length 356
Sequence MLVATMVGSLAGTARIVSLSVAGGAIATAYCRLDGMTTRFGIFLPQGWRMDLAYIADPVEQWEAMTAVAKAADAGSWDSIWLYDHFHTVPEPSANATFECWTSTAALARDTRRVNIGQMVGCNGYRNPALYAKIASTVDVASHGRLYAGIGAGWYEHEWRAYGYEWPELKDRMGAFREAVQVITGMWTQDAFEFKGKYYSVDKPYNEPKGVRKPHPSLWIGGGGEKVTLKLVAQYGDACNVGGGDPAVIREKLAILRNHCETVGRDYDQITKSTSLNVFPIRAGQDPEMVADERIRGGRSFATFADGMVIGTDAQIADEISAAIDAGIDYVILYVPGVAYDLELVSRVEAITRQFG

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
80 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
102 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
103 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 1.46
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 3.65
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10062298 3300013104 Bacteria 3538
2 JGI24740J21852_10033458 3300001979 Bacteria 1632
3 JGI24737J22298_10034456 3300001990 Bacteria 1569
4 Ga0070666_10002365 3300005335 Bacteria 11397
5 Ga0070682_100074081 3300005337 Bacteria 2185
6 Ga0070682_100236258 3300005337 Bacteria 1310
7 Ga0070668_100038618 3300005347 Bacteria 3650
8 Ga0070671_100053536 3300005355 Bacteria 3355
9 Ga0070659_100341544 3300005366 Bacteria 1254
10 Ga0070667_100002361 3300005367 Bacteria 16530
11 Ga0070667_100308608 3300005367 Bacteria 1426
12 Ga0070714_100000010 3300005435 Bacteria 262871
13 Ga0070714_100286814 3300005435 Bacteria 1531
14 Ga0070700_100000064 3300005441 Bacteria 78318
15 Ga0070708_100018459 3300005445 Bacteria 5838
16 Ga0070681_10118098 3300005458 Bacteria 2589
17 Ga0070706_100031373 3300005467 Bacteria 4900
18 Ga0070707_100018533 3300005468 Bacteria 6549
19 Ga0070707_100032743 3300005468 Bacteria 4953
20 Ga0070698_100006998 3300005471 Bacteria 12213
21 Ga0070698_100026066 3300005471 Bacteria 6088
22 Ga0070679_100083554 3300005530 Bacteria 3181
23 Ga0070679_100163595 3300005530 Bacteria 2199
24 Ga0070697_100021365 3300005536 Bacteria 5128
25 Ga0070697_100208676 3300005536 Bacteria 1662
26 Ga0070665_100033744 3300005548 Bacteria 5148
27 Ga0068855_100204140 3300005563 Bacteria 2224
28 Ga0068857_100071073 3300005577 Bacteria 3101
29 Ga0068857_100217451 3300005577 Bacteria 1745
30 Ga0068863_100002974 3300005841 Bacteria 16761
31 Ga0068863_100328735 3300005841 Bacteria 1486
32 Ga0068858_100010499 3300005842 Bacteria 8774
33 Ga0068860_100000114 3300005843 Bacteria 128789
34 Ga0081455_10019347 3300005937 Bacteria 6444
35 Ga0081455_10040113 3300005937 Bacteria 4132
36 Ga0081538_10001649 3300005981 Bacteria 22882
37 Ga0081539_10004938 3300005985 Bacteria 14193
38 Ga0081539_10004997 3300005985 Bacteria 14019
39 Ga0070717_10077326 3300006028 Bacteria 2786
40 Ga0075365_10263580 3300006038 Bacteria 1212
41 Ga0070716_100048273 3300006173 Bacteria 2406
42 Ga0075428_100007431 3300006844 Bacteria 12139
43 Ga0075430_100001518 3300006846 Bacteria 18927
44 Ga0075430_100008397 3300006846 Bacteria 8720
45 Ga0075431_100011550 3300006847 Bacteria 8908
46 Ga0075431_100348022 3300006847 Bacteria 1490
47 Ga0075429_100004496 3300006880 Bacteria 11995
48 Ga0075429_100010388 3300006880 Bacteria 8057
49 Ga0099794_10000283 3300007265 Bacteria 17529
50 Ga0105240_10045101 3300009093 Bacteria 5595
51 Ga0111539_10102933 3300009094 Bacteria 3351
52 Ga0114129_10003421 3300009147 Bacteria 22312
53 Ga0105238_10105671 3300009551 Bacteria 2797
54 Ga0105249_10077223 3300009553 Bacteria 3088
55 Ga0105239_10333768 3300010375 Bacteria 1711
56 Ga0163162_10852566 3300013306 Bacteria 1026
57 Ga0157372_10000131 3300013307 Bacteria 82235
58 Ga0157372_10243609 3300013307 Bacteria 2086
59 Ga0157372_10498371 3300013307 Bacteria 1420
60 Ga0163163_10499259 3300014325 Bacteria 1278
61 Ga0157376_10496985 3300014969 Bacteria 1198
62 Ga0206353_11147506 3300020082 Bacteria 1919
63 Ga0213875_10037502 3300021388 Bacteria 2284
64 Ga0224712_10118306 3300022467 Bacteria 1144
65 Ga0207680_10008117 3300025903 Bacteria 5143
66 Ga0207647_10023918 3300025904 Bacteria 4034
67 Ga0207684_10000263 3300025910 Bacteria 78040
68 Ga0207684_10011689 3300025910 Bacteria 7658
69 Ga0207684_10207869 3300025910 Bacteria 1688
70 Ga0207684_10510938 3300025910 Bacteria 1030
71 Ga0207695_10068025 3300025913 Bacteria 3650
72 Ga0207652_10009308 3300025921 Bacteria 7899
73 Ga0207652_10112776 3300025921 Bacteria 2413
74 Ga0207646_10001596 3300025922 Bacteria 27665
75 Ga0207646_10039306 3300025922 Bacteria 4258
76 Ga0207646_10088101 3300025922 Bacteria 2777
77 Ga0207700_10318700 3300025928 Bacteria 1347
78 Ga0207664_10000009 3300025929 Bacteria 299246
79 Ga0207644_10063134 3300025931 Bacteria 2689
80 Ga0207665_10056787 3300025939 Bacteria 2643
81 Ga0207668_10028460 3300025972 Bacteria 3654
82 Ga0207640_10202719 3300025981 Bacteria 1505
83 Ga0207703_10027960 3300026035 Bacteria 4441
84 Ga0207708_10000076 3300026075 Bacteria 78340
85 Ga0207641_10002833 3300026088 Bacteria 15762
86 Ga0207641_10219146 3300026088 Bacteria 1764
87 Ga0207676_10344343 3300026095 Bacteria 1377
88 Ga0207674_10044122 3300026116 Bacteria 4594
89 Ga0207674_10214220 3300026116 Bacteria 1875
90 Ga0207674_10267245 3300026116 Bacteria 1658
91 Ga0268266_10004850 3300028379 Bacteria 12770
92 Ga0268264_10000147 3300028381 Bacteria 164790
93 Ga0307517_10119487 3300028786 Bacteria 1956
94 Ga0307515_10258215 3300028794 Bacteria 1483
95 Ga0265338_10070713 3300028800 Bacteria 2990
96 Ga0316182_1327987 3300030745 Bacteria 1627
97 Ga0307513_10253596 3300031456 Bacteria 1554
98 Ga0307408_100288394 3300031548 Bacteria 1370
99 Ga0307408_100301174 3300031548 Bacteria 1343
100 Ga0307413_10130581 3300031824 Bacteria 1719
101 Ga0307410_10079026 3300031852 Bacteria 2304
102 Ga0307410_10295163 3300031852 Bacteria 1277
103 Ga0307416_100063786 3300032002 Bacteria 3019
104 Ga0307416_100151394 3300032002 Bacteria 2128
105 Ga0307416_100299340 3300032002 Bacteria 1598
106 Ga0307411_10409794 3300032005 Bacteria 1123
107 Ga0307415_100049145 3300032126 Bacteria 2850
108 Ga0307415_100238445 3300032126 Bacteria 1469
109 Ga0373950_0005723 3300034818 Bacteria 1865
110 Ga0373942_0000488 3300035207 Bacteria 11234
111 Ga0436364_0779129 3300037853 Bacteria 10869
112 Ga0436364_1178530 3300037853 Bacteria 1913
113 Ga0495627_071195 3300046453 Bacteria 1016
114 Ga0495630_0078783 3300046517 Bacteria 2485
115 Ga0495625_0188560 3300046660 Bacteria 1367
116 Ga0496102_0130550 3300048905 Bacteria 2351
117 Ga0496107_0148608 3300048910 Bacteria 1733
118 Ga0496110_0089582 3300048913 Bacteria 2750
119 Ga0496110_0172280 3300048913 Bacteria 1964
120 Ga0496112_0157445 3300048915 Bacteria 2238
121 Ga0501047_0214159 3300049581 Bacteria 1784
122 Ga0501070_0242330 3300049586 Bacteria 1476
123 Ga0501072_0303730 3300049588 Bacteria 1269
124 Ga0501081_0091208 3300049743 Bacteria 2143
125 Ga0501044_0363903 3300049823 Bacteria 1364
126 nmdc:mga05p37_4583_c1 3300050507 Bacteria 16161
127 nmdc:mga05p37_4721_c1 3300050507 Bacteria 15922
128 nmdc:mga09592_48439_c1 3300050508 Bacteria 3583
129 nmdc:mga0qj67_8595_c1 3300050509 Bacteria 7576
130 nmdc:mga06r32_24879_c1 3300050510 Bacteria 5565
131 nmdc:mga06r32_56538_c1 3300050510 Bacteria 3767
132 nmdc:mga08y16_569649_c1 3300050511 Bacteria 1144
133 Ga0495655_0016094 3300053083 Bacteria 1604
134 Ga0501082_0042302 3300060353 Bacteria 3928
135 2515855875 2515154155 Bacteria 7985436
136 2816421390 2816332119 Bacteria 8120218
137 2827629621 2827628540 Bacteria 6858585
138 Ga0157370_10062298
139 JGI24740J21852_10033458
140 JGI24737J22298_10034456
141 Ga0070666_10002365
142 Ga0070682_100074081
143 Ga0070682_100236258
144 Ga0070668_100038618
145 Ga0070671_100053536
146 Ga0070659_100341544
147 Ga0070667_100002361
148 Ga0070667_100308608
149 Ga0070714_100000010
150 Ga0070714_100286814
151 Ga0070700_100000064
152 Ga0070708_100018459
153 Ga0070681_10118098
154 Ga0070706_100031373
155 Ga0070707_100018533
156 Ga0070707_100032743
157 Ga0070698_100006998
158 Ga0070698_100026066
159 Ga0070679_100083554
160 Ga0070679_100163595
161 Ga0070697_100021365
162 Ga0070697_100208676
163 Ga0070665_100033744
164 Ga0068855_100204140
165 Ga0068857_100071073
166 Ga0068857_100217451
167 Ga0068863_100002974
168 Ga0068863_100328735
169 Ga0068858_100010499
170 Ga0068860_100000114
171 Ga0081455_10019347
172 Ga0081455_10040113
173 Ga0081538_10001649
174 Ga0081539_10004938
175 Ga0081539_10004997
176 Ga0070717_10077326
177 Ga0075365_10263580
178 Ga0070716_100048273
179 Ga0075428_100007431
180 Ga0075430_100001518
181 Ga0075430_100008397
182 Ga0075431_100011550
183 Ga0075431_100348022
184 Ga0075429_100004496
185 Ga0075429_100010388
186 Ga0099794_10000283
187 Ga0105240_10045101
188 Ga0111539_10102933
189 Ga0114129_10003421
190 Ga0105238_10105671
191 Ga0105249_10077223
192 Ga0105239_10333768
193 Ga0163162_10852566
194 Ga0157372_10000131
195 Ga0157372_10243609
196 Ga0157372_10498371
197 Ga0163163_10499259
198 Ga0157376_10496985
199 Ga0206353_11147506
200 Ga0213875_10037502
201 Ga0224712_10118306
202 Ga0207680_10008117
203 Ga0207647_10023918
204 Ga0207684_10000263
205 Ga0207684_10011689
206 Ga0207684_10207869
207 Ga0207684_10510938
208 Ga0207695_10068025
209 Ga0207652_10009308
210 Ga0207652_10112776
211 Ga0207646_10001596
212 Ga0207646_10039306
213 Ga0207646_10088101
214 Ga0207700_10318700
215 Ga0207664_10000009
216 Ga0207644_10063134
217 Ga0207665_10056787
218 Ga0207668_10028460
219 Ga0207640_10202719
220 Ga0207703_10027960
221 Ga0207708_10000076
222 Ga0207641_10002833
223 Ga0207641_10219146
224 Ga0207676_10344343
225 Ga0207674_10044122
226 Ga0207674_10214220
227 Ga0207674_10267245
228 Ga0268266_10004850
229 Ga0268264_10000147
230 Ga0307517_10119487
231 Ga0307515_10258215
232 Ga0265338_10070713
233 Ga0316182_1327987
234 Ga0307513_10253596
235 Ga0307408_100288394
236 Ga0307408_100301174
237 Ga0307413_10130581
238 Ga0307410_10079026
239 Ga0307410_10295163
240 Ga0307416_100063786
241 Ga0307416_100151394
242 Ga0307416_100299340
243 Ga0307411_10409794
244 Ga0307415_100049145
245 Ga0307415_100238445
246 Ga0373950_0005723
247 Ga0373942_0000488
248 Ga0436364_0779129
249 Ga0436364_1178530
250 Ga0495627_071195
251 Ga0495630_0078783
252 Ga0495625_0188560
253 Ga0496102_0130550
254 Ga0496107_0148608
255 Ga0496110_0089582
256 Ga0496110_0172280
257 Ga0496112_0157445
258 Ga0501047_0214159
259 Ga0501070_0242330
260 Ga0501072_0303730
261 Ga0501081_0091208
262 Ga0501044_0363903
263 nmdc:mga05p37_4583_c1
264 nmdc:mga05p37_4721_c1
265 nmdc:mga09592_48439_c1
266 nmdc:mga0qj67_8595_c1
267 nmdc:mga06r32_24879_c1
268 nmdc:mga06r32_56538_c1
269 nmdc:mga08y16_569649_c1
270 Ga0495655_0016094
271 Ga0501082_0042302
272 2515855875
273 2816421390
274 2827629621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

38

288

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8387 1 319
3rao-assembly2.cif.gz_B crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8176 1 318
5wan-assembly1.cif.gz_A crystal structure of a flavoenzyme ruta in the pyrimidine catabolic pathway 0.8115 1 320
3rao-assembly2.cif.gz_B crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8104 1 318
1brl-assembly2.cif.gz_C three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution 0.8097 4 317
ID Description Score Start End Superfamily
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.895 1 313 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8917 1 309 3.20.20.30
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8893 1 313 3.20.20.30
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8853 37 320 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8615 1 309 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2A6RGE1-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9686 1 320 GO:0008726
GO:0046306
AF-A0A3D3ZMN6-F1-model_v4 LLM class F420-dependent oxidoreductase 0.967 1 179 GO:0008726
GO:0046306
AF-A0A2A6RGE1-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9657 1 320 GO:0008726
GO:0046306
AF-A0A3D3ZMN6-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9617 1 179 GO:0008726
GO:0046306
AF-A0A535EJV2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9531 1 227 GO:0008726
GO:0046306

Map