F169617

General Info

Members Datasets Scaffolds Average Seq Length
137 59 274 332

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10108989|Ga0111539_101089893
Length 384
Sequence MRRLYLRDCQPGDVIEDVYVVSGKQFSATQTNKNFIKAFVSDRSCQVTARMWNATRDVFNAMPESGFLRLRGRVENYQNNLQIIIEQMWPAKDGTFEIDDLMPHTSKDIDAMCQRVFELCQSVQNRHLAALLQAYLDDEALMNDLCRAPAAMSFHHAYVGGLLEHTLNAMEVAEAIIPFYRGLNRDLVIAGIFLHDLAKTWELTYECAFGYSDGGHLVGHIVKSAMWVEHKAKDAERVLGERIPPELIDVLQHIILSHHGTPEFGAARCPSTPEAIAVHMIENLDAKLMMSLTATRGDGTTGEGNWTEYMKAFNGRLFRPDLAPAEASDAGDPLPIDGRGTFRVTPAAHVGSGANHNSGNGEGPTMKLAITNPLFENAQPQRKK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
17 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
23 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
24 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
25 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
26 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
27 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
30 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
31 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
32 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
33 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
36 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
39 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
40 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
41 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
42 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
43 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
44 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
45 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
46 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
47 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
48 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
55 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
56 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
57 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
58 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
59 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 1.46
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 83.21
Stem 0
Stem Tuber 0
Unclassified 10.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10108989 3300009094 Bacteria 3250
2 Ga0070658_10002544 3300005327 Bacteria 15208
3 Ga0070675_100036625 3300005354 Bacteria 3994
4 Ga0070671_100178763 3300005355 Unclassified 1796
5 Ga0070671_100388108 3300005355 Bacteria 1194
6 Ga0070673_100061253 3300005364 Bacteria 2985
7 Ga0070688_100078399 3300005365 Bacteria 2131
8 Ga0070672_100115706 3300005543 Bacteria 2190
9 Ga0070704_100146848 3300005549 Bacteria 1849
10 Ga0081539_10013015 3300005985 Bacteria 6316
11 Ga0070717_10040192 3300006028 Bacteria 3809
12 Ga0105245_10088784 3300009098 Bacteria 2840
13 Ga0105237_10304139 3300009545 Bacteria 1598
14 Ga0157370_10018436 3300013104 Bacteria 7018
15 Ga0157370_10034544 3300013104 Bacteria 4921
16 Ga0157370_10068260 3300013104 Bacteria 3360
17 Ga0157369_10019155 3300013105 Bacteria 7659
18 Ga0157369_10199047 3300013105 Unclassified 2103
19 Ga0157372_10272233 3300013307 Unclassified 1968
20 Ga0157379_10109765 3300014968 Bacteria 2478
21 Ga0207705_10003429 3300025909 Bacteria 12062
22 Ga0207695_10000223 3300025913 Bacteria 151749
23 Ga0207659_10030814 3300025926 Bacteria 3667
24 Ga0207644_10188841 3300025931 Unclassified 1619
25 Ga0207691_10136597 3300025940 Bacteria 2162
26 Ga0265339_10006439 3300031249 Bacteria 7699
27 Ga0316575_10001198 3300031665 Bacteria 8195
28 Ga0316575_10003259 3300031665 Bacteria 5577
29 Ga0316575_10004100 3300031665 Bacteria 5106
30 Ga0316579_10000306 3300031691 Bacteria 15080
31 Ga0316579_10000981 3300031691 Bacteria 9998
32 Ga0316579_10006466 3300031691 Bacteria 4785
33 Ga0316579_10015333 3300031691 Bacteria 3325
34 Ga0316579_10016780 3300031691 Bacteria 3204
35 Ga0316579_10047557 3300031691 Bacteria 2003
36 Ga0316579_10131128 3300031691 Bacteria 1207
37 Ga0316576_10002077 3300031727 Bacteria 11250
38 Ga0316576_10003480 3300031727 Bacteria 9239
39 Ga0316576_10012381 3300031727 Bacteria 5631
40 Ga0316576_10025515 3300031727 Unclassified 4139
41 Ga0316576_10052787 3300031727 Bacteria 2960
42 Ga0316576_10078292 3300031727 Bacteria 2450
43 Ga0316576_10138338 3300031727 Bacteria 1833
44 Ga0316576_10167893 3300031727 Bacteria 1656
45 Ga0316578_10002319 3300031728 Bacteria 8276
46 Ga0316578_10007761 3300031728 Bacteria 5411
47 Ga0316578_10014255 3300031728 Bacteria 4239
48 Ga0316578_10017134 3300031728 Bacteria 3939
49 Ga0316578_10021620 3300031728 Bacteria 3572
50 Ga0316578_10042213 3300031728 Unclassified 2643
51 Ga0316578_10119743 3300031728 Bacteria 1582
52 Ga0316577_10000292 3300031733 Bacteria 18171
53 Ga0316577_10006042 3300031733 Bacteria 6380
54 Ga0316577_10012902 3300031733 Bacteria 4560
55 Ga0316577_10021800 3300031733 Unclassified 3554
56 Ga0316577_10022157 3300031733 Bacteria 3527
57 Ga0316577_10027585 3300031733 Bacteria 3167
58 Ga0316577_10076168 3300031733 Bacteria 1873
59 Ga0307410_10048107 3300031852 Bacteria 2854
60 Ga0307406_10106995 3300031901 Bacteria 1917
61 Ga0316583_10000271 3300032133 Bacteria 14285
62 Ga0316583_10001399 3300032133 Bacteria 8028
63 Ga0316583_10018015 3300032133 Unclassified 2536
64 Ga0316583_10021337 3300032133 Bacteria 2322
65 Ga0316583_10035873 3300032133 Bacteria 1760
66 Ga0316585_10000845 3300032137 Bacteria 7773
67 Ga0316585_10001403 3300032137 Bacteria 6352
68 Ga0316585_10002096 3300032137 Bacteria 5355
69 Ga0316585_10003635 3300032137 Bacteria 4250
70 Ga0316580_10001719 3300032139 Bacteria 5837
71 Ga0316593_10007406 3300032168 Bacteria 3015
72 Ga0316588_1010569 3300033528 Bacteria 1949
73 Ga0316574_0000550 3300035398 Bacteria 15524
74 Ga0316574_0005682 3300035398 Bacteria 6675
75 Ga0316574_0006920 3300035398 Bacteria 6173
76 Ga0316574_0015444 3300035398 Bacteria 4431
77 Ga0316574_0042432 3300035398 Bacteria 2806
78 Ga0316574_0044548 3300035398 Unclassified 2745
79 Ga0316574_0086792 3300035398 Bacteria 1991
80 Ga0316574_0167721 3300035398 Unclassified 1414
81 Ga0316574_0182615 3300035398 Bacteria 1349
82 Ga0316582_0000084 3300036647 Bacteria 24652
83 Ga0316582_0005471 3300036647 Bacteria 6547
84 Ga0316582_0007358 3300036647 Bacteria 5856
85 Ga0316582_0025068 3300036647 Bacteria 3576
86 Ga0316582_0088894 3300036647 Unclassified 2030
87 Ga0316584_0000219 3300036712 Bacteria 28153
88 Ga0316584_0007274 3300036712 Bacteria 7557
89 Ga0316584_0011048 3300036712 Bacteria 6328
90 Ga0316584_0014095 3300036712 Bacteria 5678
91 Ga0316584_0026613 3300036712 Bacteria 4252
92 Ga0316584_0093801 3300036712 Bacteria 2247
93 Ga0316584_0129881 3300036712 Unclassified 1882
94 Ga0316584_0153290 3300036712 Bacteria 1715
95 Ga0316584_0206814 3300036712 Bacteria 1446
96 Ga0316584_0229149 3300036712 Bacteria 1362
97 Ga0316581_0000540 3300037588 Bacteria 7380
98 Ga0316581_0022144 3300037588 Unclassified 1873
99 Ga0400484_02860 3300038725 Bacteria 5342
100 Ga0400484_15368 3300038725 Bacteria 4435
101 Ga0400490_03967 3300038726 Bacteria 30300
102 Ga0400490_28865 3300038726 Unclassified 3616
103 Ga0400490_53573 3300038726 Bacteria 17078
104 Ga0400491_02300 3300038727 Bacteria 2019
105 Ga0400491_08992 3300038727 Bacteria 3269
106 Ga0400485_15693 3300038735 Bacteria 23942
107 Ga0400485_19305 3300038735 Bacteria 30675
108 Ga0400488_32749 3300038741 Bacteria 17258
109 Ga0400486_00732 3300038742 Bacteria 1533
110 Ga0400486_32414 3300038742 Bacteria 97031
111 Ga0400483_004656 3300039062 Bacteria 7418
112 Ga0400483_071076 3300039062 Bacteria 2368
113 Ga0400483_202988 3300039062 Bacteria 4746
114 Ga0400489_19416 3300039093 Bacteria 74597
115 Ga0400489_21431 3300039093 Bacteria 13434
116 Ga0400489_69468 3300039093 Bacteria 1440
117 Ga0400489_81741 3300039093 Bacteria 61469
118 Ga0400487_23340 3300039110 Bacteria 18713
119 Ga0400487_42389 3300039110 Bacteria 30104
120 Ga0400487_60191 3300039110 Bacteria 7191
121 Ga0451855_0574372 3300041511 Bacteria 2880
122 Ga0451577_0024629 3300042876 Bacteria 5473
123 Ga0451577_0372717 3300042876 Bacteria 1295
124 Ga0451577_0443205 3300042876 Bacteria 1179
125 Ga0453684_0086620 3300044712 Bacteria 3886
126 Ga0451576_0004550 3300045051 Bacteria 17955
127 Ga0451576_0005388 3300045051 Bacteria 16079
128 Ga0501034_0008220 3300049571 Bacteria 11056
129 Ga0501037_0086223 3300049573 Bacteria 2273
130 Ga0501080_0002658 3300049742 Bacteria 15633
131 Ga0501080_0048510 3300049742 Bacteria 3952
132 Ga0501083_0055676 3300049744 Unclassified 2651
133 Ga0501044_0001335 3300049823 Bacteria 29013
134 Ga0501044_0072804 3300049823 Bacteria 3493
135 nmdc:mga08y16_394059_c1 3300050511 Bacteria 1418
136 Ga0501082_0148464 3300060353 Bacteria 2036
137 2524001558 2523533628 Bacteria 4098242
138 Ga0111539_10108989
139 Ga0070658_10002544
140 Ga0070675_100036625
141 Ga0070671_100178763
142 Ga0070671_100388108
143 Ga0070673_100061253
144 Ga0070688_100078399
145 Ga0070672_100115706
146 Ga0070704_100146848
147 Ga0081539_10013015
148 Ga0070717_10040192
149 Ga0105245_10088784
150 Ga0105237_10304139
151 Ga0157370_10018436
152 Ga0157370_10034544
153 Ga0157370_10068260
154 Ga0157369_10019155
155 Ga0157369_10199047
156 Ga0157372_10272233
157 Ga0157379_10109765
158 Ga0207705_10003429
159 Ga0207695_10000223
160 Ga0207659_10030814
161 Ga0207644_10188841
162 Ga0207691_10136597
163 Ga0265339_10006439
164 Ga0316575_10001198
165 Ga0316575_10003259
166 Ga0316575_10004100
167 Ga0316579_10000306
168 Ga0316579_10000981
169 Ga0316579_10006466
170 Ga0316579_10015333
171 Ga0316579_10016780
172 Ga0316579_10047557
173 Ga0316579_10131128
174 Ga0316576_10002077
175 Ga0316576_10003480
176 Ga0316576_10012381
177 Ga0316576_10025515
178 Ga0316576_10052787
179 Ga0316576_10078292
180 Ga0316576_10138338
181 Ga0316576_10167893
182 Ga0316578_10002319
183 Ga0316578_10007761
184 Ga0316578_10014255
185 Ga0316578_10017134
186 Ga0316578_10021620
187 Ga0316578_10042213
188 Ga0316578_10119743
189 Ga0316577_10000292
190 Ga0316577_10006042
191 Ga0316577_10012902
192 Ga0316577_10021800
193 Ga0316577_10022157
194 Ga0316577_10027585
195 Ga0316577_10076168
196 Ga0307410_10048107
197 Ga0307406_10106995
198 Ga0316583_10000271
199 Ga0316583_10001399
200 Ga0316583_10018015
201 Ga0316583_10021337
202 Ga0316583_10035873
203 Ga0316585_10000845
204 Ga0316585_10001403
205 Ga0316585_10002096
206 Ga0316585_10003635
207 Ga0316580_10001719
208 Ga0316593_10007406
209 Ga0316588_1010569
210 Ga0316574_0000550
211 Ga0316574_0005682
212 Ga0316574_0006920
213 Ga0316574_0015444
214 Ga0316574_0042432
215 Ga0316574_0044548
216 Ga0316574_0086792
217 Ga0316574_0167721
218 Ga0316574_0182615
219 Ga0316582_0000084
220 Ga0316582_0005471
221 Ga0316582_0007358
222 Ga0316582_0025068
223 Ga0316582_0088894
224 Ga0316584_0000219
225 Ga0316584_0007274
226 Ga0316584_0011048
227 Ga0316584_0014095
228 Ga0316584_0026613
229 Ga0316584_0093801
230 Ga0316584_0129881
231 Ga0316584_0153290
232 Ga0316584_0206814
233 Ga0316584_0229149
234 Ga0316581_0000540
235 Ga0316581_0022144
236 Ga0400484_02860
237 Ga0400484_15368
238 Ga0400490_03967
239 Ga0400490_28865
240 Ga0400490_53573
241 Ga0400491_02300
242 Ga0400491_08992
243 Ga0400485_15693
244 Ga0400485_19305
245 Ga0400488_32749
246 Ga0400486_00732
247 Ga0400486_32414
248 Ga0400483_004656
249 Ga0400483_071076
250 Ga0400483_202988
251 Ga0400489_19416
252 Ga0400489_21431
253 Ga0400489_69468
254 Ga0400489_81741
255 Ga0400487_23340
256 Ga0400487_42389
257 Ga0400487_60191
258 Ga0451855_0574372
259 Ga0451577_0024629
260 Ga0451577_0372717
261 Ga0451577_0443205
262 Ga0453684_0086620
263 Ga0451576_0004550
264 Ga0451576_0005388
265 Ga0501034_0008220
266 Ga0501037_0086223
267 Ga0501080_0002658
268 Ga0501080_0048510
269 Ga0501083_0055676
270 Ga0501044_0001335
271 Ga0501044_0072804
272 nmdc:mga08y16_394059_c1
273 Ga0501082_0148464
274 2524001558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

162

287

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z6k-assembly2.cif.gz_B crystal structure of full-length human rpa14/32 heterodimer 0.8491 14 93
1quq-assembly3.cif.gz_A complex of replication protein a subunits rpa14 and rpa32 0.8438 14 93
3kdf-assembly3.cif.gz_D x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression 0.8423 14 93
1quq-assembly2.cif.gz_C complex of replication protein a subunits rpa14 and rpa32 0.8406 18 93
1l1o-assembly1.cif.gz_E structure of the human replication protein a (rpa) trimerization core 0.8405 14 93
ID Description Score Start End Superfamily
af_Q2G2T1_22_97_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9284 25 92 2.40.50.140
af_Q2G2T1_122_299_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9178 123 308 1.10.3210.10
af_Q2G2T1_122_299_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.908 123 308 1.10.3210.10
af_Q6YZ49_4_118_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8615 18 89 2.40.50.140
af_Q9F1K0_916_986_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8613 23 89 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A534UAN0-F1-model_v4 HD domain-containing protein 0.9637 107 204 GO:0016787
GO:0031125
AF-X0VIC3-F1-model_v4 HD Cas3-type domain-containing protein 0.9636 122 317 GO:0016787
GO:0031125
AF-A0A0S8GSN4-F1-model_v4 HD/PDEase domain-containing protein 0.962 2 317 GO:0016787
GO:0031125
AF-I0ICX8-F1-model_v4 Putative ribonuclease 0.9583 4 317 GO:0016787
GO:0031125
AF-A0A3M2CL36-F1-model_v4 HD domain-containing protein 0.952 3 320 GO:0016787
GO:0031125

Map