F167099

General Info

Members Datasets Scaffolds Average Seq Length
136 105 117 407

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10005564|Ga0307513_100055649
Length 467
Sequence MGMDESEIRLRAGAAEDWDAISDLMGYLFHETQTAELRASEGSVFEPERSIVAVDGEAIVGHAGAYTRDLTVPGGIVPAAHVTLVGVAPTHRRRGLLTRMMKRQLGEIAEAGREPVASLWASETKIYPRYGYGHAAQQMRLQAMTREIRPPELPADGYDGRLRLVTPVDAIGEFAKVYEQLRPDRTGWSSRDERWWKFVLDDPESHREGATVLHGVVHDTPHGPTGYAIWRTLGRWEEYGPNAEILIREVTAADPQAYAALWRFLLTIDLARTAKASYLALDEPLLHLVDEPRRLGTRVSDGLWIRVVDVPGALAARRYRCPIDVVFDVTDPLLPRNSGRWRLTGDPQTASCTRTDDPADLACTVLELGTAYLGGPSLASLAAAGLVRELTPGALNAASMAFGWHRLPNPVETRSEMRPAAVGSRLWANPNVDAAGCVPHTPRRIRPGYPLRAPRRPRVLRPPTRPM

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
4 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
7 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
8 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
9 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
10 2855683550 Micromonospora sp. RP3T Isolate Unclassified
11 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
12 2858868258 Micromonospora sp. MH33 Isolate Unclassified
13 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
14 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
15 2902582711 Micromonospora sp. AP08 Isolate Unclassified
16 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
17 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
18 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
54 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
55 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
61 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
71 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
72 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
73 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
74 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
75 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
76 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
77 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
78 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
79 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
80 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
81 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
94 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
101 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
102 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.03
Metatranscriptomes 0
Isolates 13.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.71
Nodule 0
Rhizoplane 8.09
Rhizosphere 45.59
Stem 0
Stem Tuber 0
Unclassified 31.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10285561 3300003322 Bacteria 2342
2 Ga0070668_100000205 3300005347 Bacteria 38963
3 Ga0070668_100109487 3300005347 Bacteria 2198
4 Ga0070667_100003143 3300005367 Bacteria 14174
5 Ga0068860_100204236 3300005843 Bacteria 1916
6 Ga0068862_100067901 3300005844 Bacteria 3075
7 Ga0081539_10001651 3300005985 Bacteria 36188
8 Ga0081539_10003264 3300005985 Bacteria 20355
9 Ga0081539_10013474 3300005985 Bacteria 6157
10 Ga0075365_10011556 3300006038 Bacteria 5197
11 Ga0075365_10119151 3300006038 Bacteria 1819
12 Ga0075363_100003455 3300006048 Bacteria 6720
13 Ga0075364_10020173 3300006051 Bacteria 4191
14 Ga0075364_10068125 3300006051 Bacteria 2340
15 Ga0075364_10149215 3300006051 Bacteria 1575
16 Ga0075367_10043441 3300006178 Bacteria 2632
17 Ga0075369_10001118 3300006186 Bacteria 9013
18 Ga0075369_10002712 3300006186 Bacteria 6349
19 Ga0075370_10000952 3300006353 Bacteria 11912
20 Ga0075428_100122768 3300006844 Bacteria 2827
21 Ga0075430_100008175 3300006846 Bacteria 8841
22 Ga0075429_100005616 3300006880 Bacteria 10808
23 Ga0114129_10017074 3300009147 Bacteria 10333
24 Ga0105239_10003782 3300010375 Bacteria 18420
25 Ga0207661_10053247 3300025944 Bacteria 3238
26 Ga0207668_10000612 3300025972 Bacteria 22218
27 Ga0207658_10002554 3300025986 Bacteria 13226
28 Ga0207658_10160341 3300025986 Bacteria 1843
29 Ga0307515_10000217 3300028794 Bacteria 142129
30 Ga0307515_10017327 3300028794 Bacteria 13128
31 Ga0307515_10017714 3300028794 Bacteria 12950
32 Ga0307515_10077565 3300028794 Bacteria 4386
33 Ga0307512_10008273 3300030522 Bacteria 10167
34 Ga0307512_10008657 3300030522 Bacteria 9888
35 Ga0265327_10000445 3300031251 Bacteria 74683
36 Ga0265327_10006455 3300031251 Bacteria 9368
37 Ga0265327_10013110 3300031251 Bacteria 5529
38 Ga0307513_10005564 3300031456 Bacteria 16614
39 Ga0307513_10078777 3300031456 Bacteria 3407
40 Ga0307509_10161001 3300031507 Bacteria 2142
41 Ga0307509_10235531 3300031507 Bacteria 1629
42 Ga0307508_10016748 3300031616 Bacteria 6669
43 Ga0307516_10002098 3300031730 Bacteria 27110
44 Ga0307516_10075599 3300031730 Bacteria 3222
45 Ga0307413_10120188 3300031824 Bacteria 1778
46 Ga0307406_10034290 3300031901 Bacteria 3113
47 Ga0307407_10062122 3300031903 Bacteria 2186
48 Ga0307409_100019309 3300031995 Bacteria 4610
49 Ga0307409_100038599 3300031995 Bacteria 3534
50 Ga0307416_100178055 3300032002 Bacteria 1989
51 Ga0307415_100042238 3300032126 Bacteria 3033
52 Ga0307415_100122993 3300032126 Bacteria 1949
53 Ga0307415_100195789 3300032126 Bacteria 1599
54 Ga0307507_10030627 3300033179 Bacteria 5669
55 Ga0373941_0023967 3300035115 Bacteria 1748
56 Ga0373942_0000267 3300035207 Bacteria 13986
57 Ga0373962_0001373 3300035242 Bacteria 5737
58 Ga0373937_0059814 3300036401 Bacteria 3502
59 Ga0439448_0024984 3300042005 Bacteria 1871
60 Ga0466963_0048120 3300044694 Bacteria 2816
61 Ga0466967_0278114 3300045976 Bacteria 1605
62 Ga0495656_0050091 3300046615 Bacteria 1782
63 Ga0496100_0000225 3300048903 Bacteria 30548
64 Ga0496101_0000118 3300048904 Bacteria 77684
65 Ga0496102_0045263 3300048905 Bacteria 3995
66 Ga0496103_0002879 3300048906 Bacteria 10677
67 Ga0496106_0016880 3300048909 Bacteria 5402
68 Ga0496107_0000106 3300048910 Bacteria 40710
69 Ga0496109_0000077 3300048912 Bacteria 103492
70 Ga0496110_0000645 3300048913 Bacteria 23879
71 Ga0496111_0000485 3300048914 Bacteria 20417
72 Ga0496114_0000880 3300048917 Bacteria 22492
73 Ga0496115_0096956 3300048918 Bacteria 2415
74 Ga0496116_0005986 3300048919 Bacteria 11154
75 Ga0496117_0007608 3300048920 Bacteria 10525
76 Ga0496117_0066014 3300048920 Bacteria 2456
77 Ga0496118_0005885 3300048921 Bacteria 13737
78 Ga0496119_0039889 3300048922 Bacteria 3012
79 Ga0496120_0088795 3300048923 Bacteria 1656
80 Ga0496121_0000002 3300048924 Bacteria 1494588
81 Ga0496122_0000051 3300048925 Bacteria 265104
82 Ga0496123_0006894 3300048926 Bacteria 10874
83 Ga0496124_0000002 3300048927 Bacteria 1494588
84 Ga0496125_0000002 3300048928 Bacteria 1480920
85 Ga0496126_0000011 3300048929 Bacteria 744275
86 Ga0501032_0001399 3300049569 Bacteria 19177
87 Ga0501032_0025808 3300049569 Bacteria 4048
88 Ga0501034_0019757 3300049571 Bacteria 6886
89 Ga0501034_0053288 3300049571 Bacteria 4074
90 Ga0501036_0273370 3300049572 Bacteria 1414
91 Ga0501037_0000494 3300049573 Bacteria 31857
92 Ga0501037_0012682 3300049573 Bacteria 6208
93 Ga0501038_0028527 3300049574 Bacteria 4958
94 Ga0501038_0029327 3300049574 Bacteria 4877
95 Ga0501039_0036414 3300049575 Bacteria 3797
96 Ga0501040_0150990 3300049576 Bacteria 1639
97 Ga0501043_0001466 3300049579 Bacteria 20632
98 Ga0501043_0036481 3300049579 Bacteria 3868
99 Ga0501070_0004156 3300049586 Bacteria 12454
100 Ga0501070_0018887 3300049586 Bacteria 5782
101 Ga0501044_0003682 3300049823 Bacteria 17229
102 Ga0501044_0006155 3300049823 Bacteria 13255
103 nmdc:mga03n38_1628_c2 3300050490 Bacteria 5767
104 nmdc:mga00v17_16281_c1 3300050491 Bacteria 4191
105 nmdc:mga06z11_115034_c1 3300050494 Bacteria 1494
106 nmdc:mga07m45_13989_c1 3300050496 Bacteria 4266
107 nmdc:mga05p37_18794_c1 3300050507 Bacteria 8353
108 nmdc:mga09592_19632_c1 3300050508 Bacteria 5550
109 nmdc:mga09592_21184_c1 3300050508 Bacteria 5356
110 nmdc:mga09592_473654_c1 3300050508 Bacteria 1079
111 nmdc:mga0qj67_289540_c1 3300050509 Bacteria 1327
112 nmdc:mga0sz30_3586_c1 3300050516 Bacteria 5595
113 nmdc:mga0sz30_407_c1 3300050516 Bacteria 14982
114 Ga0500650_0044748 3300053098 Bacteria 2049
115 Ga0500652_000960 3300053131 Bacteria 9527
116 Ga0500568_0000146 3300053139 Bacteria 62144
117 Ga0500616_0041304 3300053153 Bacteria 2476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_289540_c1 nmdc:mga0qj67_289540_c1_304_1296 314
2 3300042005 Ga0439448_0024984 Ga0439448_0024984_27_1040 319
3 3300048909 Ga0496106_0016880 Ga0496106_0016880_4373_5386 319
4 3300053153 Ga0500616_0041304 Ga0500616_0041304_49_1071 322
5 3300050508 nmdc:mga09592_473654_c1 nmdc:mga09592_473654_c1_23_1057 328
6 3300035115 Ga0373941_0023967 Ga0373941_0023967_485_1696 373
7 3300035207 Ga0373942_0000267 Ga0373942_0000267_10047_11258 373
8 iso_pu_bacteria 2866065130 2866067167 373
9 3300050516 nmdc:mga0sz30_3586_c1 nmdc:mga0sz30_3586_c1_1219_2409 378
10 3300053131 Ga0500652_000960 Ga0500652_000960_1527_2717 378
11 3300006186 Ga0075369_10002712 Ga0075369_100027129 381
12 3300033179 Ga0307507_10030627 Ga0307507_100306277 381
13 3300035242 Ga0373962_0001373 Ga0373962_0001373_4162_5355 381
14 iso_pu_bacteria 2929212328 2929215959 381
15 3300028794 Ga0307515_10017714 Ga0307515_100177147 382
16 iso_pu_bacteria 2996221748 2996224482 383
17 3300044694 Ga0466963_0048120 Ga0466963_0048120_1507_2715 384
18 iso_pu_bacteria 3006393351 3006394429 384
19 3300006038 Ga0075365_10011556 Ga0075365_100115566 385
20 3300006038 Ga0075365_10119151 Ga0075365_101191513 385
21 3300006048 Ga0075363_100003455 Ga0075363_1000034556 385
22 3300006051 Ga0075364_10068125 Ga0075364_100681252 385
23 3300006186 Ga0075369_10001118 Ga0075369_100011189 385
24 3300006353 Ga0075370_10000952 Ga0075370_100009529 385
25 3300050490 nmdc:mga03n38_1628_c2 nmdc:mga03n38_1628_c2_3029_4240 385
26 3300050496 nmdc:mga07m45_13989_c1 nmdc:mga07m45_13989_c1_1081_2292 385
27 3300050516 nmdc:mga0sz30_407_c1 nmdc:mga0sz30_407_c1_6141_7352 385
28 3300010375 Ga0105239_10003782 Ga0105239_1000378210 386
29 iso_pu_bacteria 2501939600 2501945650 386
30 iso_pu_bacteria 2855683550 2855689224 386
31 iso_pu_bacteria 2856858025 2856858225 386
32 iso_pu_bacteria 2858868258 2858874981 386
33 iso_pu_bacteria 2902582711 2902584125 386
34 3300006051 Ga0075364_10020173 Ga0075364_100201732 387
35 3300006178 Ga0075367_10043441 Ga0075367_100434412 387
36 3300048923 Ga0496120_0088795 Ga0496120_0088795_197_1414 387
37 3300050491 nmdc:mga00v17_16281_c1 nmdc:mga00v17_16281_c1_1502_2746 387
38 3300050494 nmdc:mga06z11_115034_c1 nmdc:mga06z11_115034_c1_173_1417 387
39 iso_pu_bacteria 2558860112 2558907654 387
40 iso_pu_bacteria 2751185782 2753268498 387
41 3300006051 Ga0075364_10149215 Ga0075364_101492152 388
42 iso_pu_bacteria 2675903059 2676482546 388
43 3300005347 Ga0070668_100000205 Ga0070668_10000020526 389
44 3300005844 Ga0068862_100067901 Ga0068862_1000679013 389
45 3300025972 Ga0207668_10000612 Ga0207668_1000061225 389
46 iso_pu_bacteria 2738541264 2738664523 389
47 iso_pu_bacteria 2738541356 2739143658 389
48 iso_pu_bacteria 2831935698 2831939515 389
49 3300049569 Ga0501032_0025808 Ga0501032_0025808_1772_3007 390
50 3300049571 Ga0501034_0019757 Ga0501034_0019757_4343_5578 390
51 3300049573 Ga0501037_0000494 Ga0501037_0000494_1497_2732 390
52 3300049574 Ga0501038_0029327 Ga0501038_0029327_1300_2535 390
53 3300049579 Ga0501043_0036481 Ga0501043_0036481_951_2186 390
54 3300049586 Ga0501070_0018887 Ga0501070_0018887_1785_3020 390
55 3300049823 Ga0501044_0006155 Ga0501044_0006155_7762_8997 390
56 iso_pu_bacteria 2622736626 2623591297 390
57 iso_pu_bacteria 2832004796 2832008628 390
58 iso_pu_bacteria 2867507094 2867510046 390
59 3300005347 Ga0070668_100109487 Ga0070668_1001094871 391
60 3300005843 Ga0068860_100204236 Ga0068860_1002042361 391
61 3300006844 Ga0075428_100122768 Ga0075428_1001227683 391
62 3300006846 Ga0075430_100008175 Ga0075430_1000081755 391
63 3300009147 Ga0114129_10017074 Ga0114129_1001707411 391
64 3300025986 Ga0207658_10160341 Ga0207658_101603412 391
65 3300031507 Ga0307509_10161001 Ga0307509_101610012 391
66 3300050507 nmdc:mga05p37_18794_c1 nmdc:mga05p37_18794_c1_1813_3036 391
67 3300050508 nmdc:mga09592_19632_c1 nmdc:mga09592_19632_c1_668_1891 391
68 3300005985 Ga0081539_10003264 Ga0081539_1000326416 392
69 3300031251 Ga0265327_10000445 Ga0265327_1000044522 392
70 3300031251 Ga0265327_10013110 Ga0265327_100131104 392
71 3300031901 Ga0307406_10034290 Ga0307406_100342902 392
72 3300031995 Ga0307409_100019309 Ga0307409_1000193092 392
73 3300036401 Ga0373937_0059814 Ga0373937_0059814_568_1797 392
74 3300049569 Ga0501032_0001399 Ga0501032_0001399_8324_9562 392
75 3300049571 Ga0501034_0053288 Ga0501034_0053288_961_2199 392
76 3300049572 Ga0501036_0273370 Ga0501036_0273370_41_1279 392
77 3300049573 Ga0501037_0012682 Ga0501037_0012682_2968_4206 392
78 3300049574 Ga0501038_0028527 Ga0501038_0028527_3317_4555 392
79 3300049575 Ga0501039_0036414 Ga0501039_0036414_1542_2780 392
80 3300049576 Ga0501040_0150990 Ga0501040_0150990_60_1298 392
81 3300049579 Ga0501043_0001466 Ga0501043_0001466_17866_19104 392
82 3300049586 Ga0501070_0004156 Ga0501070_0004156_9688_10926 392
83 3300049823 Ga0501044_0003682 Ga0501044_0003682_1184_2422 392
84 3300005367 Ga0070667_100003143 Ga0070667_1000031435 393
85 3300025986 Ga0207658_10002554 Ga0207658_1000255410 393
86 3300031251 Ga0265327_10006455 Ga0265327_100064555 393
87 3300045976 Ga0466967_0278114 Ga0466967_0278114_353_1594 393
88 3300048903 Ga0496100_0000225 Ga0496100_0000225_21565_22806 393
89 3300048904 Ga0496101_0000118 Ga0496101_0000118_28743_29984 393
90 3300048905 Ga0496102_0045263 Ga0496102_0045263_224_1465 393
91 3300048906 Ga0496103_0002879 Ga0496103_0002879_8740_9981 393
92 3300048910 Ga0496107_0000106 Ga0496107_0000106_10741_11982 393
93 3300048912 Ga0496109_0000077 Ga0496109_0000077_93958_95199 393
94 3300048913 Ga0496110_0000645 Ga0496110_0000645_20180_21421 393
95 3300048914 Ga0496111_0000485 Ga0496111_0000485_18350_19591 393
96 3300048917 Ga0496114_0000880 Ga0496114_0000880_16196_17437 393
97 3300048918 Ga0496115_0096956 Ga0496115_0096956_131_1372 393
98 3300048919 Ga0496116_0005986 Ga0496116_0005986_8091_9332 393
99 3300048920 Ga0496117_0007608 Ga0496117_0007608_1194_2435 393
100 3300048920 Ga0496117_0066014 Ga0496117_0066014_24_1265 393
101 3300048921 Ga0496118_0005885 Ga0496118_0005885_9197_10438 393
102 3300048922 Ga0496119_0039889 Ga0496119_0039889_986_2227 393
103 3300048924 Ga0496121_0000002 Ga0496121_0000002_1117313_1118554 393
104 3300048925 Ga0496122_0000051 Ga0496122_0000051_240659_241900 393
105 3300048926 Ga0496123_0006894 Ga0496123_0006894_6152_7393 393
106 3300048927 Ga0496124_0000002 Ga0496124_0000002_376035_377276 393
107 3300048928 Ga0496125_0000002 Ga0496125_0000002_1117313_1118554 393
108 3300048929 Ga0496126_0000011 Ga0496126_0000011_376035_377276 393
109 3300005985 Ga0081539_10001651 Ga0081539_100016514 395
110 3300005985 Ga0081539_10013474 Ga0081539_1001347410 395
111 3300031456 Ga0307513_10078777 Ga0307513_100787773 395
112 3300031824 Ga0307413_10120188 Ga0307413_101201882 395
113 3300031903 Ga0307407_10062122 Ga0307407_100621222 395
114 3300031995 Ga0307409_100038599 Ga0307409_1000385991 395
115 3300032126 Ga0307415_100042238 Ga0307415_1000422382 395
116 3300028794 Ga0307515_10000217 Ga0307515_10000217134 396
117 3300031730 Ga0307516_10002098 Ga0307516_1000209820 396
118 3300031730 Ga0307516_10075599 Ga0307516_100755993 396
119 3300032002 Ga0307416_100178055 Ga0307416_1001780553 396
120 3300032126 Ga0307415_100122993 Ga0307415_1001229932 396
121 3300032126 Ga0307415_100195789 Ga0307415_1001957891 396
122 3300046615 Ga0495656_0050091 Ga0495656_0050091_194_1438 396
123 3300053139 Ga0500568_0000146 Ga0500568_0000146_16514_17758 397
124 3300028794 Ga0307515_10017327 Ga0307515_1001732712 398
125 3300028794 Ga0307515_10077565 Ga0307515_100775654 398
126 3300030522 Ga0307512_10008273 Ga0307512_100082737 398
127 3300030522 Ga0307512_10008657 Ga0307512_1000865710 398
128 3300031456 Ga0307513_10005564 Ga0307513_100055649 398
129 3300031507 Ga0307509_10235531 Ga0307509_102355312 398
130 3300031616 Ga0307508_10016748 Ga0307508_100167485 398
131 3300053098 Ga0500650_0044748 Ga0500650_0044748_94_1338 398
132 iso_pu_bacteria 649633069 649813536 398
133 3300025944 Ga0207661_10053247 Ga0207661_100532473 402
134 3300003322 rootL2_10285561 rootL2_102855612 403
135 3300006880 Ga0075429_100005616 Ga0075429_1000056165 403
136 3300050508 nmdc:mga09592_21184_c1 nmdc:mga09592_21184_c1_1100_2389 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

9

135

0.97

PF17668

Acetyltransf_17

Acetyltransferase (GNAT) domain

187

307

0.89

PF13530

SCP2_2

Sterol carrier protein domain

310

409

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

17

124

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rfy-assembly1.cif.gz_D crystal structure of eis2 form mycobacterium abscessus 0.8989 12 398
6rft-assembly1.cif.gz_C crystal structure of eis2 from mycobacterium abscessus bound to acetyl-coa 0.8975 12 398
6rfy-assembly1.cif.gz_B crystal structure of eis2 form mycobacterium abscessus 0.8958 12 398
6rft-assembly1.cif.gz_B crystal structure of eis2 from mycobacterium abscessus bound to acetyl-coa 0.8956 14 398
6rfx-assembly1.cif.gz_C crystal structure of eis2 from mycobacterium abscessus 0.8954 12 398
ID Description Score Start End Superfamily
af_Q4DM71_170_362_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.898 84 124 3.40.630.30
3sxoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8858 13 138 3.40.630.30
2i00C01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.873 13 137 3.40.630.30
2ozgA03 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8698 308 391 3.30.1050.10
4my0C01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8662 13 137 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2E2AL76-F1-model_v4 N-acetyltransferase domain-containing protein 0.9596 14 117 GO:0030649
GO:0034069
AF-A0A2E2AL76-F1-model_v4 N-acetyltransferase domain-containing protein 0.9335 14 117 GO:0030649
GO:0034069
AF-A0A1K0FYM9-F1-model_v4 GNAT family N-acetyltransferase 0.9299 14 403 GO:0030649
GO:0034069
AF-A0A538D3L4-F1-model_v4 GNAT family N-acetyltransferase 0.9282 1 306 GO:0030649
GO:0034069
AF-A0A0A6UGT0-F1-model_v4 Acetyltransferase 0.9278 14 403 GO:0030649
GO:0034069

Feature Viewer

pLDDT pTM Quality
84.08 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map