F167078

General Info

Members Datasets Scaffolds Average Seq Length
136 115 272 212

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10020680|Ga0265332_100206803
Length 239
Sequence MSDSEPASASASPGSXXXXGEPGRTKWVVFLIVAALSLIADQATKVWARDALPVARIRGGDGACIVPDDLARPSAPARPGQPADLRPACAGTPVPVVSGFWEWRLSMNPGSAFGLFSSQEGARIGLSVVGIIAVFGMLWMLRKARSDQRILHWALALVAGGAVGNLIDRIYFGVVTDFILWRYQSHEWPVFNVADIVLVVGVGLMFIDIQKEGRREKALKSGRQARAKAAGLVKTFSGK

Samples

Sample ID Description Type Environment
1 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
68 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
71 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
78 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
97 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
98 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
104 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
105 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
106 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
107 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
108 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
109 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
110 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
111 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
114 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
115 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 2.21
Rhizosphere 77.94
Stem 0
Stem Tuber 0
Unclassified 11.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265332_10020680 3300031238 Bacteria 2906
2 Ga0070690_100008688 3300005330 Bacteria 5861
3 Ga0070670_100565555 3300005331 Bacteria 1015
4 Ga0068869_100033032 3300005334 Bacteria 3651
5 Ga0070689_100211088 3300005340 Bacteria 1589
6 Ga0070674_100546065 3300005356 Bacteria 972
7 Ga0070688_100323049 3300005365 Bacteria 1122
8 Ga0070705_100049316 3300005440 Bacteria 2444
9 Ga0070705_100368849 3300005440 Unclassified 1053
10 Ga0070694_100193965 3300005444 Bacteria 1510
11 Ga0070708_100225737 3300005445 Bacteria 1757
12 Ga0070678_100002185 3300005456 Bacteria 10631
13 Ga0070681_10617209 3300005458 Bacteria 999
14 Ga0070685_10146547 3300005466 Bacteria 1492
15 Ga0070706_100114078 3300005467 Bacteria 2516
16 Ga0070706_100910981 3300005467 Bacteria 812
17 Ga0070698_100004570 3300005471 Bacteria 15197
18 Ga0070665_100013149 3300005548 Bacteria 8336
19 Ga0068855_100193584 3300005563 Bacteria 2292
20 Ga0068855_100548264 3300005563 Bacteria 1252
21 Ga0068857_100222910 3300005577 Bacteria 1723
22 Ga0068864_100636904 3300005618 Bacteria 1037
23 Ga0068861_100049122 3300005719 Bacteria 3193
24 Ga0068870_10176731 3300005840 Bacteria 1278
25 Ga0068863_100011435 3300005841 Bacteria 8583
26 Ga0068858_100994033 3300005842 Bacteria 822
27 Ga0068860_100325976 3300005843 Bacteria 1508
28 Ga0068862_100201506 3300005844 Unclassified 1795
29 Ga0070717_10049222 3300006028 Bacteria 3459
30 Ga0070717_10052038 3300006028 Bacteria 3372
31 Ga0068871_100401959 3300006358 Bacteria 1220
32 Ga0075429_100109595 3300006880 Bacteria 2414
33 Ga0068865_100043994 3300006881 Bacteria 3054
34 Ga0075435_100051283 3300007076 Bacteria 3323
35 Ga0105245_10000686 3300009098 Bacteria 30522
36 Ga0105249_10102545 3300009553 Bacteria 2693
37 Ga0105239_10170720 3300010375 Bacteria 2432
38 Ga0157371_10305272 3300013102 Bacteria 1153
39 Ga0157374_10064584 3300013296 Bacteria 3435
40 Ga0157378_10318729 3300013297 Bacteria 1510
41 Ga0157378_10847486 3300013297 Unclassified 942
42 Ga0157376_10286073 3300014969 Unclassified 1555
43 Ga0207705_10469040 3300025909 Bacteria 977
44 Ga0207684_10093797 3300025910 Bacteria 2560
45 Ga0207684_10322283 3300025910 Bacteria 1332
46 Ga0207660_10208793 3300025917 Bacteria 1528
47 Ga0207662_10172847 3300025918 Bacteria 1386
48 Ga0207652_10022994 3300025921 Bacteria 5164
49 Ga0207650_10543716 3300025925 Bacteria 973
50 Ga0207687_10000876 3300025927 Bacteria 20380
51 Ga0207670_10089492 3300025936 Bacteria 2173
52 Ga0207670_10265381 3300025936 Bacteria 1332
53 Ga0207669_10080517 3300025937 Bacteria 2083
54 Ga0207689_10021033 3300025942 Bacteria 5484
55 Ga0207689_10179044 3300025942 Unclassified 1748
56 Ga0207667_10276964 3300025949 Bacteria 1715
57 Ga0207708_10067489 3300026075 Bacteria 2736
58 Ga0207702_10640107 3300026078 Bacteria 1045
59 Ga0207641_10006417 3300026088 Bacteria 9912
60 Ga0207676_10576463 3300026095 Bacteria 1078
61 Ga0207676_10782759 3300026095 Bacteria 930
62 Ga0207674_10121624 3300026116 Bacteria 2578
63 Ga0207675_100037877 3300026118 Bacteria 4499
64 Ga0207683_10003161 3300026121 Bacteria 14375
65 Ga0268266_10010902 3300028379 Bacteria 7914
66 Ga0268266_10552394 3300028379 Bacteria 1104
67 Ga0268265_10682058 3300028380 Bacteria 991
68 Ga0307517_10192795 3300028786 Bacteria 1289
69 Ga0307515_10011891 3300028794 Bacteria 16446
70 Ga0265338_10036492 3300028800 Bacteria 4702
71 Ga0265320_10154917 3300031240 Bacteria 1034
72 Ga0307513_10003508 3300031456 Bacteria 21231
73 Ga0307509_10000029 3300031507 Bacteria 215555
74 Ga0307509_10012894 3300031507 Bacteria 9937
75 Ga0307509_10027610 3300031507 Bacteria 6315
76 Ga0307509_10208070 3300031507 Bacteria 1785
77 Ga0307509_10208225 3300031507 Unclassified 1784
78 Ga0307508_10119715 3300031616 Bacteria 2235
79 Ga0265314_10190061 3300031711 Unclassified 1223
80 Ga0307516_10072827 3300031730 Bacteria 3294
81 Ga0373944_0086900 3300035089 Bacteria 1040
82 Ga0373949_0001700 3300035090 Bacteria 6106
83 Ga0373936_0000001 3300035113 Bacteria 456155
84 Ga0373941_0001946 3300035115 Bacteria 4474
85 Ga0373961_0000001 3300035241 Bacteria 199721
86 Ga0395899_0013994 3300037312 Bacteria 6124
87 Ga0395900_0111730 3300037418 Bacteria 2806
88 Ga0395898_0189562 3300037466 Unclassified 1965
89 Ga0395905_0619321 3300037471 Bacteria 984
90 Ga0395901_0297297 3300038443 Unclassified 1674
91 Ga0451793_0651442 3300041452 Bacteria 1972
92 Ga0451839_1572094 3300041496 Bacteria 1024
93 Ga0466967_0317461 3300045976 Bacteria 1502
94 Ga0495638_0242901 3300046460 Bacteria 996
95 Ga0495649_0196793 3300046694 Unclassified 1048
96 Ga0496105_0428972 3300048908 Bacteria 1046
97 Ga0496115_0300229 3300048918 Bacteria 1316
98 Ga0501032_0293000 3300049569 Bacteria 1053
99 Ga0501034_0237222 3300049571 Bacteria 1771
100 Ga0501037_0517834 3300049573 Bacteria 808
101 Ga0501038_0426847 3300049574 Bacteria 1022
102 Ga0501046_0309352 3300049580 Bacteria 1153
103 Ga0501047_0116706 3300049581 Unclassified 2551
104 Ga0501047_0399231 3300049581 Bacteria 1208
105 Ga0501047_0404138 3300049581 Bacteria 1198
106 Ga0501067_0295354 3300049583 Bacteria 902
107 Ga0501068_0181895 3300049584 Unclassified 1329
108 Ga0501070_0043747 3300049586 Bacteria 3727
109 Ga0501070_0082354 3300049586 Bacteria 2663
110 Ga0501071_0139902 3300049587 Bacteria 1802
111 Ga0501072_0241477 3300049588 Bacteria 1439
112 Ga0501073_0173289 3300049589 Bacteria 1494
113 Ga0501217_025867 3300049661 Bacteria 1415
114 Ga0501227_002549 3300049665 Bacteria 4017
115 Ga0501227_010202 3300049665 Bacteria 2033
116 Ga0501225_0019810 3300049705 Unclassified 1860
117 Ga0501080_0235262 3300049742 Bacteria 1674
118 Ga0501035_0117189 3300049822 Bacteria 2331
119 Ga0501044_0037526 3300049823 Bacteria 5064
120 nmdc:mga0n895_1018643_c1 3300050512 Unclassified 808
121 Ga0500583_0079306 3300053092 Bacteria 1584
122 Ga0500566_0009391 3300053094 Bacteria 5781
123 Ga0500566_0014255 3300053094 Bacteria 4674
124 Ga0500566_0069973 3300053094 Unclassified 1971
125 Ga0500640_000034 3300053095 Bacteria 20779
126 Ga0500554_000229 3300053102 Bacteria 12022
127 Ga0500572_002776 3300053111 Bacteria 4133
128 Ga0500595_000105 3300053119 Bacteria 57146
129 Ga0500597_005515 3300053120 Bacteria 4092
130 Ga0500597_028430 3300053120 Bacteria 2281
131 Ga0500614_000597 3300053123 Bacteria 9200
132 Ga0500559_0007631 3300053136 Bacteria 4777
133 Ga0500568_0020968 3300053139 Unclassified 2818
134 Ga0500603_001548 3300053150 Bacteria 5227
135 Ga0500636_0026792 3300053177 Bacteria 3405
136 Ga0500637_0184640 3300053178 Bacteria 1194
137 Ga0265332_10020680
138 Ga0070690_100008688
139 Ga0070670_100565555
140 Ga0068869_100033032
141 Ga0070689_100211088
142 Ga0070674_100546065
143 Ga0070688_100323049
144 Ga0070705_100049316
145 Ga0070705_100368849
146 Ga0070694_100193965
147 Ga0070708_100225737
148 Ga0070678_100002185
149 Ga0070681_10617209
150 Ga0070685_10146547
151 Ga0070706_100114078
152 Ga0070706_100910981
153 Ga0070698_100004570
154 Ga0070665_100013149
155 Ga0068855_100193584
156 Ga0068855_100548264
157 Ga0068857_100222910
158 Ga0068864_100636904
159 Ga0068861_100049122
160 Ga0068870_10176731
161 Ga0068863_100011435
162 Ga0068858_100994033
163 Ga0068860_100325976
164 Ga0068862_100201506
165 Ga0070717_10049222
166 Ga0070717_10052038
167 Ga0068871_100401959
168 Ga0075429_100109595
169 Ga0068865_100043994
170 Ga0075435_100051283
171 Ga0105245_10000686
172 Ga0105249_10102545
173 Ga0105239_10170720
174 Ga0157371_10305272
175 Ga0157374_10064584
176 Ga0157378_10318729
177 Ga0157378_10847486
178 Ga0157376_10286073
179 Ga0207705_10469040
180 Ga0207684_10093797
181 Ga0207684_10322283
182 Ga0207660_10208793
183 Ga0207662_10172847
184 Ga0207652_10022994
185 Ga0207650_10543716
186 Ga0207687_10000876
187 Ga0207670_10089492
188 Ga0207670_10265381
189 Ga0207669_10080517
190 Ga0207689_10021033
191 Ga0207689_10179044
192 Ga0207667_10276964
193 Ga0207708_10067489
194 Ga0207702_10640107
195 Ga0207641_10006417
196 Ga0207676_10576463
197 Ga0207676_10782759
198 Ga0207674_10121624
199 Ga0207675_100037877
200 Ga0207683_10003161
201 Ga0268266_10010902
202 Ga0268266_10552394
203 Ga0268265_10682058
204 Ga0307517_10192795
205 Ga0307515_10011891
206 Ga0265338_10036492
207 Ga0265320_10154917
208 Ga0307513_10003508
209 Ga0307509_10000029
210 Ga0307509_10012894
211 Ga0307509_10027610
212 Ga0307509_10208070
213 Ga0307509_10208225
214 Ga0307508_10119715
215 Ga0265314_10190061
216 Ga0307516_10072827
217 Ga0373944_0086900
218 Ga0373949_0001700
219 Ga0373936_0000001
220 Ga0373941_0001946
221 Ga0373961_0000001
222 Ga0395899_0013994
223 Ga0395900_0111730
224 Ga0395898_0189562
225 Ga0395905_0619321
226 Ga0395901_0297297
227 Ga0451793_0651442
228 Ga0451839_1572094
229 Ga0466967_0317461
230 Ga0495638_0242901
231 Ga0495649_0196793
232 Ga0496105_0428972
233 Ga0496115_0300229
234 Ga0501032_0293000
235 Ga0501034_0237222
236 Ga0501037_0517834
237 Ga0501038_0426847
238 Ga0501046_0309352
239 Ga0501047_0116706
240 Ga0501047_0399231
241 Ga0501047_0404138
242 Ga0501067_0295354
243 Ga0501068_0181895
244 Ga0501070_0043747
245 Ga0501070_0082354
246 Ga0501071_0139902
247 Ga0501072_0241477
248 Ga0501073_0173289
249 Ga0501217_025867
250 Ga0501227_002549
251 Ga0501227_010202
252 Ga0501225_0019810
253 Ga0501080_0235262
254 Ga0501035_0117189
255 Ga0501044_0037526
256 nmdc:mga0n895_1018643_c1
257 Ga0500583_0079306
258 Ga0500566_0009391
259 Ga0500566_0014255
260 Ga0500566_0069973
261 Ga0500640_000034
262 Ga0500554_000229
263 Ga0500572_002776
264 Ga0500595_000105
265 Ga0500597_005515
266 Ga0500597_028430
267 Ga0500614_000597
268 Ga0500559_0007631
269 Ga0500568_0020968
270 Ga0500603_001548
271 Ga0500636_0026792
272 Ga0500637_0184640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

33

211

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.9104 19 184
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.899 17 182
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8873 19 184
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.8711 17 180
6ryo-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 1.9 a resolution 0.871 18 184
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8755 23 183 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8598 23 185 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8467 23 183 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8428 23 185 3.90.1420.10
af_P9WK99_39_178_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8316 23 182 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A7W0ZZU7-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9627 19 196 GO:0004190
GO:0005886
GO:0006508
AF-A0A3M2BNI1-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9512 14 188 GO:0004190
GO:0005886
GO:0006508
AF-A0A536BYQ7-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9486 16 182 GO:0004190
GO:0005886
GO:0006508
AF-M1YLE2-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9467 13 188 GO:0004190
GO:0005886
GO:0006508
AF-A0A0X8X888-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9454 17 188 GO:0004190
GO:0005886
GO:0006508

Map