F162637

General Info

Members Datasets Scaffolds Average Seq Length
135 63 135 411

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000344|Ga0068855_1000003444
Length 439
Sequence VYGGRQAPVSFSAKAPIGMKFIDEVSITVAAGNGGDGIVAWRREKYVDMGGPAGGDXXXXGSVYVEATTALSTLVEFRFKRHFAAEAGKAGGGARKSGPSGKDLIIPVPVGTLVYRTAEGQSEAFLADLAEPGARVQVAKGGRGGLGNQHFATPKRQAPHFAEKGEPAEICGLRLELRLLADAGIVGVPNAGKSTLLSVISAARPKIADYPFTTVEPQLGVVRVSDEESFVAVDVPGLIEGAHEGAGLGDQFLRHVERTRVLVHMLDGAKSLDEILHDKTIIEAELGAWNPKLPEKPTMIVVSKLDLPDARERMEELRERFPEIRGISAATGEGVSDLVYAMAATIAQTPLPALADQPPAHIALAPKNAFTIERDEDGTFVIRGARVERLAAMTDFDSDEGLARFERILNKLGVEKKLRDMGAQEGDSVRISDFEFSYS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
5 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
8 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
9 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
10 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
11 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
12 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
13 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
14 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
21 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
22 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
23 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
24 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
25 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
26 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
27 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
28 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
29 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
30 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
31 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
32 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
33 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
34 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
35 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
38 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
39 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
40 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
44 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
45 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
51 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
63 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 3.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 83.7
Stem 0
Stem Tuber 0
Unclassified 16.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100067832 3300005329 Bacteria 3323
2 Ga0070691_10003565 3300005341 Bacteria 7021
3 Ga0070714_100007252 3300005435 Bacteria 8615
4 Ga0070714_100072868 3300005435 Bacteria 2974
5 Ga0068855_100000344 3300005563 Bacteria 57763
6 Ga0068855_100016748 3300005563 Bacteria 8815
7 Ga0068855_100272930 3300005563 Bacteria 1880
8 Ga0068854_100000002 3300005578 Bacteria 362695
9 Ga0068856_100002920 3300005614 Bacteria 17508
10 Ga0068856_100110136 3300005614 Bacteria 2750
11 Ga0105240_10311611 3300009093 Bacteria 1797
12 Ga0157374_10025304 3300013296 Bacteria 5327
13 Ga0206356_10844274 3300020070 Bacteria 10517
14 Ga0213874_10029340 3300021377 Bacteria 1578
15 Ga0213876_10000977 3300021384 Bacteria 18827
16 Ga0213875_10000001 3300021388 Bacteria 2793540
17 Ga0213875_10001433 3300021388 Bacteria 15482
18 Ga0213875_10073210 3300021388 Bacteria 1599
19 Ga0213871_10000882 3300021441 Bacteria 4573
20 Ga0207664_10083383 3300025929 Bacteria 2605
21 Ga0207661_10099846 3300025944 Bacteria 2435
22 Ga0207667_10000161 3300025949 Bacteria 98927
23 Ga0207667_10003510 3300025949 Bacteria 19383
24 Ga0207667_10201283 3300025949 Bacteria 2043
25 Ga0207640_10000006 3300025981 Bacteria 313289
26 Ga0207678_10075853 3300026067 Bacteria 2880
27 Ga0207702_10005458 3300026078 Bacteria 11125
28 Ga0265356_1002120 3300028017 Bacteria 2716
29 Ga0265334_10013941 3300028573 Bacteria 3358
30 Ga0265318_10006300 3300028577 Bacteria 5480
31 Ga0265338_10008076 3300028800 Bacteria 12864
32 Ga0265338_10052820 3300028800 Bacteria 3642
33 Ga0265332_10021809 3300031238 Bacteria 2828
34 Ga0265320_10019255 3300031240 Bacteria 3737
35 Ga0265325_10002169 3300031241 Bacteria 13384
36 Ga0265325_10032902 3300031241 Bacteria 2766
37 Ga0265340_10006088 3300031247 Bacteria 6650
38 Ga0265340_10059765 3300031247 Bacteria 1828
39 Ga0265331_10035349 3300031250 Bacteria 2458
40 Ga0265327_10026191 3300031251 Bacteria 3383
41 Ga0265316_10009830 3300031344 Bacteria 8777
42 Ga0265316_10042272 3300031344 Bacteria 3644
43 Ga0265313_10003347 3300031595 Bacteria 13096
44 Ga0316579_10000570 3300031691 Bacteria 12315
45 Ga0265342_10000813 3300031712 Bacteria 31313
46 Ga0316576_10001025 3300031727 Bacteria 14446
47 Ga0316576_10001720 3300031727 Bacteria 12040
48 Ga0316576_10024879 3300031727 Unclassified 4185
49 Ga0316576_10027293 3300031727 Bacteria 4013
50 Ga0316578_10008306 3300031728 Bacteria 5276
51 Ga0316578_10015183 3300031728 Bacteria 4136
52 Ga0316578_10032299 3300031728 Unclassified 2989
53 Ga0316578_10039710 3300031728 Unclassified 2719
54 Ga0316578_10113393 3300031728 Bacteria 1629
55 Ga0316577_10002168 3300031733 Bacteria 9622
56 Ga0316577_10011845 3300031733 Unclassified 4735
57 Ga0316577_10025506 3300031733 Bacteria 3288
58 Ga0316583_10009108 3300032133 Unclassified 3580
59 Ga0316585_10007835 3300032137 Unclassified 3087
60 Ga0316580_10000156 3300032139 Bacteria 13412
61 Ga0316580_10013453 3300032139 Bacteria 2495
62 Ga0316580_10016234 3300032139 Bacteria 2283
63 Ga0316593_10001338 3300032168 Bacteria 5380
64 Ga0316588_1015547 3300033528 Bacteria 1677
65 Ga0316596_1000564 3300033541 Bacteria 6475
66 Ga0316596_1007829 3300033541 Bacteria 2531
67 Ga0316574_0003312 3300035398 Bacteria 8284
68 Ga0316574_0013611 3300035398 Bacteria 4682
69 Ga0316574_0146491 3300035398 Bacteria 1522
70 Ga0316582_0000107 3300036647 Bacteria 23451
71 Ga0316582_0005084 3300036647 Bacteria 6728
72 Ga0316582_0016009 3300036647 Bacteria 4303
73 Ga0316582_0031773 3300036647 Bacteria 3230
74 Ga0316582_0155564 3300036647 Bacteria 1547
75 Ga0316584_0004846 3300036712 Bacteria 8952
76 Ga0316584_0008926 3300036712 Bacteria 6935
77 Ga0316584_0019307 3300036712 Bacteria 4927
78 Ga0316584_0032541 3300036712 Bacteria 3860
79 Ga0316584_0225029 3300036712 Bacteria 1377
80 Ga0395899_0006139 3300037312 Bacteria 9313
81 Ga0395898_0004012 3300037466 Bacteria 16187
82 Ga0316581_0000136 3300037588 Bacteria 11003
83 Ga0436364_0115970 3300037853 Bacteria 16388
84 Ga0436364_0202176 3300037853 Bacteria 41706
85 Ga0436364_0273345 3300037853 Bacteria 2794207
86 Ga0436364_0805710 3300037853 Bacteria 2259
87 Ga0436364_0831778 3300037853 Bacteria 9609
88 Ga0436364_1071179 3300037853 Bacteria 26836
89 Ga0436364_1232957 3300037853 Bacteria 3551
90 Ga0436364_1301420 3300037853 Bacteria 24711
91 Ga0436364_1565148 3300037853 Bacteria 5350
92 Ga0400483_115707 3300039062 Bacteria 7199
93 Ga0400489_07282 3300039093 Bacteria 32992
94 Ga0436365_0131875 3300039437 Bacteria 6302
95 Ga0436365_0177974 3300039437 Bacteria 19021
96 Ga0436365_1147457 3300039437 Bacteria 3235
97 Ga0436360_0077242 3300039438 Bacteria 5716
98 Ga0436360_0241721 3300039438 Bacteria 20223
99 Ga0436360_0579439 3300039438 Bacteria 2244
100 Ga0436360_0736346 3300039438 Bacteria 1757
101 Ga0436360_0852032 3300039438 Bacteria 1790
102 Ga0436361_0329650 3300039447 Bacteria 2313
103 Ga0436361_0434638 3300039447 Bacteria 42089
104 Ga0436361_0576711 3300039447 Bacteria 25198
105 Ga0436361_0924710 3300039447 Bacteria 13927
106 Ga0436361_0984651 3300039447 Bacteria 1938
107 Ga0436363_0461872 3300039450 Bacteria 118070
108 Ga0436363_0718080 3300039450 Bacteria 1312
109 Ga0436363_1717599 3300039450 Bacteria 2479
110 Ga0436362_0524553 3300039453 Bacteria 8733
111 Ga0436362_0528839 3300039453 Bacteria 1610
112 Ga0436362_1062883 3300039453 Bacteria 6603
113 Ga0436362_1096154 3300039453 Bacteria 3346
114 Ga0451577_0139893 3300042876 Bacteria 2175
115 Ga0453683_0008957 3300044673 Bacteria 6692
116 Ga0453683_0017224 3300044673 Bacteria 4655
117 Ga0453683_0048104 3300044673 Bacteria 2675
118 Ga0453684_0000128 3300044712 Bacteria 335864
119 Ga0453684_0000484 3300044712 Bacteria 157641
120 Ga0453684_0001419 3300044712 Bacteria 68999
121 Ga0453684_0002086 3300044712 Bacteria 50721
122 Ga0453684_0003349 3300044712 Bacteria 36288
123 Ga0453684_0019312 3300044712 Bacteria 10387
124 Ga0453684_0036082 3300044712 Bacteria 6820
125 Ga0453684_0054351 3300044712 Bacteria 5216
126 Ga0453684_0140089 3300044712 Bacteria 2890
127 Ga0453684_0172550 3300044712 Bacteria 2547
128 Ga0453684_0430738 3300044712 Bacteria 1472
129 Ga0451576_0000775 3300045051 Bacteria 62938
130 Ga0451576_0008024 3300045051 Bacteria 12464
131 Ga0451576_0035751 3300045051 Bacteria 5268
132 Ga0466958_0009232 3300045836 Bacteria 5489
133 Ga0466958_0011304 3300045836 Bacteria 5026
134 Ga0501073_0085796 3300049589 Bacteria 2190
135 Ga0501076_0032608 3300049592 Bacteria 4066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0225029 Ga0316584_0225029_269_1330 338
2 3300044673 Ga0453683_0048104 Ga0453683_0048104_1611_2645 338
3 3300039438 Ga0436360_0077242 Ga0436360_0077242_976_2157 363
4 3300042876 Ga0451577_0139893 Ga0451577_0139893_151_1443 364
5 3300044712 Ga0453684_0036082 Ga0453684_0036082_5191_6483 364
6 3300049589 Ga0501073_0085796 Ga0501073_0085796_31_1236 377
7 3300044712 Ga0453684_0000128 Ga0453684_0000128_296224_297489 379
8 3300044712 Ga0453684_0430738 Ga0453684_0430738_96_1358 384
9 3300045051 Ga0451576_0008024 Ga0451576_0008024_2717_3985 385
10 3300028017 Ga0265356_1002120 Ga0265356_10021204 387
11 3300037853 Ga0436364_1232957 Ga0436364_1232957_862_2127 390
12 3300031691 Ga0316579_10000570 Ga0316579_100005708 391
13 3300031727 Ga0316576_10001025 Ga0316576_100010257 391
14 3300031728 Ga0316578_10032299 Ga0316578_100322994 391
15 3300031733 Ga0316577_10011845 Ga0316577_100118452 391
16 3300032133 Ga0316583_10009108 Ga0316583_100091082 391
17 3300032137 Ga0316585_10007835 Ga0316585_100078351 391
18 3300032139 Ga0316580_10000156 Ga0316580_100001567 391
19 3300032168 Ga0316593_10001338 Ga0316593_100013386 391
20 3300033541 Ga0316596_1000564 Ga0316596_10005642 391
21 3300035398 Ga0316574_0003312 Ga0316574_0003312_1161_2420 391
22 3300036647 Ga0316582_0005084 Ga0316582_0005084_2705_3964 391
23 3300036712 Ga0316584_0004846 Ga0316584_0004846_824_2089 391
24 3300037588 Ga0316581_0000136 Ga0316581_0000136_8062_9321 391
25 3300039062 Ga0400483_115707 Ga0400483_115707_5680_6957 391
26 3300039453 Ga0436362_1096154 Ga0436362_1096154_1574_2833 393
27 3300036647 Ga0316582_0000107 Ga0316582_0000107_6989_8248 397
28 3300036647 Ga0316582_0031773 Ga0316582_0031773_1604_2869 400
29 3300039438 Ga0436360_0736346 Ga0436360_0736346_183_1448 400
30 3300044712 Ga0453684_0054351 Ga0453684_0054351_3934_5199 400
31 3300045051 Ga0451576_0035751 Ga0451576_0035751_76_1341 400
32 3300049592 Ga0501076_0032608 Ga0501076_0032608_2095_3360 400
33 3300031733 Ga0316577_10002168 Ga0316577_100021685 401
34 3300036712 Ga0316584_0008926 Ga0316584_0008926_4655_5917 401
35 3300031727 Ga0316576_10001720 Ga0316576_100017203 403
36 3300031727 Ga0316576_10024879 Ga0316576_100248792 403
37 3300031727 Ga0316576_10027293 Ga0316576_100272933 403
38 3300031728 Ga0316578_10008306 Ga0316578_100083061 403
39 3300031728 Ga0316578_10039710 Ga0316578_100397103 403
40 3300031728 Ga0316578_10113393 Ga0316578_101133932 403
41 3300032139 Ga0316580_10013453 Ga0316580_100134532 403
42 3300032139 Ga0316580_10016234 Ga0316580_100162343 403
43 3300033528 Ga0316588_1015547 Ga0316588_10155471 403
44 3300033541 Ga0316596_1007829 Ga0316596_10078292 403
45 3300035398 Ga0316574_0013611 Ga0316574_0013611_2401_3660 403
46 3300035398 Ga0316574_0146491 Ga0316574_0146491_52_1311 403
47 3300036647 Ga0316582_0155564 Ga0316582_0155564_47_1324 403
48 3300036712 Ga0316584_0019307 Ga0316584_0019307_2411_3670 403
49 3300031728 Ga0316578_10015183 Ga0316578_100151831 404
50 3300044712 Ga0453684_0000484 Ga0453684_0000484_47732_49021 404
51 3300044712 Ga0453684_0002086 Ga0453684_0002086_4095_5360 404
52 3300044712 Ga0453684_0003349 Ga0453684_0003349_25636_26928 404
53 3300044712 Ga0453684_0019312 Ga0453684_0019312_5776_7041 404
54 3300028573 Ga0265334_10013941 Ga0265334_100139413 405
55 3300028577 Ga0265318_10006300 Ga0265318_100063005 405
56 3300028800 Ga0265338_10052820 Ga0265338_100528203 405
57 3300031240 Ga0265320_10019255 Ga0265320_100192554 405
58 3300031247 Ga0265340_10006088 Ga0265340_100060886 405
59 3300031250 Ga0265331_10035349 Ga0265331_100353492 405
60 3300031344 Ga0265316_10042272 Ga0265316_100422722 405
61 3300037853 Ga0436364_0115970 Ga0436364_0115970_11058_12317 405
62 3300044673 Ga0453683_0008957 Ga0453683_0008957_4883_6148 405
63 3300044673 Ga0453683_0017224 Ga0453683_0017224_1348_2613 405
64 3300044712 Ga0453684_0001419 Ga0453684_0001419_9010_10278 405
65 3300044712 Ga0453684_0140089 Ga0453684_0140089_1562_2827 405
66 3300044712 Ga0453684_0172550 Ga0453684_0172550_1158_2423 405
67 3300045051 Ga0451576_0000775 Ga0451576_0000775_25414_26679 405
68 3300031733 Ga0316577_10025506 Ga0316577_100255063 406
69 3300036647 Ga0316582_0016009 Ga0316582_0016009_1500_2774 406
70 3300039093 Ga0400489_07282 Ga0400489_07282_30891_32195 406
71 3300021388 Ga0213875_10000001 Ga0213875_100000011392 407
72 3300036712 Ga0316584_0032541 Ga0316584_0032541_1574_2848 407
73 3300037853 Ga0436364_0273345 Ga0436364_0273345_1444993_1446258 407
74 3300005435 Ga0070714_100007252 Ga0070714_1000072525 409
75 3300005578 Ga0068854_100000002 Ga0068854_10000000260 409
76 3300005614 Ga0068856_100002920 Ga0068856_1000029209 409
77 3300009093 Ga0105240_10311611 Ga0105240_103116112 409
78 3300020070 Ga0206356_10844274 Ga0206356_108442749 409
79 3300025981 Ga0207640_10000006 Ga0207640_10000006252 409
80 3300026078 Ga0207702_10005458 Ga0207702_100054585 409
81 3300021384 Ga0213876_10000977 Ga0213876_1000097711 410
82 3300039437 Ga0436365_0177974 Ga0436365_0177974_7768_9030 410
83 3300039437 Ga0436365_1147457 Ga0436365_1147457_1521_2798 410
84 3300039438 Ga0436360_0579439 Ga0436360_0579439_771_2036 410
85 3300039450 Ga0436363_0461872 Ga0436363_0461872_92538_93800 410
86 3300039453 Ga0436362_1062883 Ga0436362_1062883_1438_2700 410
87 3300021388 Ga0213875_10073210 Ga0213875_100732102 411
88 3300028800 Ga0265338_10008076 Ga0265338_1000807615 411
89 3300031238 Ga0265332_10021809 Ga0265332_100218093 411
90 3300031241 Ga0265325_10002169 Ga0265325_100021692 411
91 3300031251 Ga0265327_10026191 Ga0265327_100261914 411
92 3300031344 Ga0265316_10009830 Ga0265316_100098303 411
93 3300031595 Ga0265313_10003347 Ga0265313_100033476 411
94 3300031712 Ga0265342_10000813 Ga0265342_1000081329 411
95 3300037853 Ga0436364_0805710 Ga0436364_0805710_712_1977 411
96 3300037853 Ga0436364_1071179 Ga0436364_1071179_8847_10112 411
97 3300039437 Ga0436365_0131875 Ga0436365_0131875_73_1332 411
98 3300005435 Ga0070714_100072868 Ga0070714_1000728683 412
99 3300005563 Ga0068855_100272930 Ga0068855_1002729302 412
100 3300021377 Ga0213874_10029340 Ga0213874_100293402 412
101 3300021388 Ga0213875_10001433 Ga0213875_1000143311 412
102 3300021441 Ga0213871_10000882 Ga0213871_100008822 412
103 3300025929 Ga0207664_10083383 Ga0207664_100833833 412
104 3300025949 Ga0207667_10201283 Ga0207667_102012832 412
105 3300031241 Ga0265325_10032902 Ga0265325_100329023 412
106 3300031247 Ga0265340_10059765 Ga0265340_100597652 412
107 3300037312 Ga0395899_0006139 Ga0395899_0006139_7407_8669 412
108 3300037466 Ga0395898_0004012 Ga0395898_0004012_4013_5275 412
109 3300037853 Ga0436364_0202176 Ga0436364_0202176_22623_23906 412
110 3300037853 Ga0436364_0831778 Ga0436364_0831778_960_2237 412
111 3300037853 Ga0436364_1301420 Ga0436364_1301420_14522_15799 412
112 3300037853 Ga0436364_1565148 Ga0436364_1565148_43_1320 412
113 3300039438 Ga0436360_0241721 Ga0436360_0241721_12265_13542 412
114 3300039447 Ga0436361_0576711 Ga0436361_0576711_22919_24184 412
115 3300039447 Ga0436361_0924710 Ga0436361_0924710_254_1537 412
116 3300039450 Ga0436363_1717599 Ga0436363_1717599_109_1386 412
117 3300045836 Ga0466958_0009232 Ga0466958_0009232_2163_3425 412
118 3300045836 Ga0466958_0011304 Ga0466958_0011304_412_1674 412
119 3300005329 Ga0070683_100067832 Ga0070683_1000678323 413
120 3300005341 Ga0070691_10003565 Ga0070691_100035653 413
121 3300005563 Ga0068855_100000344 Ga0068855_1000003444 413
122 3300005563 Ga0068855_100016748 Ga0068855_1000167489 413
123 3300005614 Ga0068856_100110136 Ga0068856_1001101363 413
124 3300013296 Ga0157374_10025304 Ga0157374_100253043 413
125 3300025944 Ga0207661_10099846 Ga0207661_100998463 413
126 3300025949 Ga0207667_10000161 Ga0207667_1000016150 413
127 3300025949 Ga0207667_10003510 Ga0207667_100035108 413
128 3300026067 Ga0207678_10075853 Ga0207678_100758532 413
129 3300039438 Ga0436360_0852032 Ga0436360_0852032_121_1386 413
130 3300039447 Ga0436361_0329650 Ga0436361_0329650_244_1509 413
131 3300039447 Ga0436361_0434638 Ga0436361_0434638_8665_9930 413
132 3300039447 Ga0436361_0984651 Ga0436361_0984651_573_1838 413
133 3300039450 Ga0436363_0718080 Ga0436363_0718080_15_1280 413
134 3300039453 Ga0436362_0524553 Ga0436362_0524553_334_1599 413
135 3300039453 Ga0436362_0528839 Ga0436362_0528839_38_1303 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09269

DUF1967

Domain of unknown function (DUF1967)

370

438

0.98

PF01018

GTP1_OBG

GTP1/OBG

22

179

0.96

PF01926

MMR_HSR1

50S ribosome-binding GTPase

182

304

0.85

PF02421

FeoB_N

Ferrous iron transport protein B

181

285

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bl6-assembly1.cif.gz_9 50s-obge-gmppnp particle 0.8009 1 326
3a1w-assembly1.cif.gz_A crystal structue of the g domain of t. maritima feob iron iransporter 0.7768 157 318
7bl6-assembly1.cif.gz_9 50s-obge-gmppnp particle 0.7734 1 326
7oht-assembly1.cif.gz_b nog1-tap associated immature ribosomal particles from s. cerevisiae after rpl2 expression shut down, population a 0.7584 156 322
3a1v-assembly1.cif.gz_A crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form 0.7491 157 327
ID Description Score Start End Superfamily
af_Q2FXT1_359_430_3.30.300.350 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;GTP-binding protein OBG, C-terminal domain 0.9854 343 412 3.30.300.350
af_P9WMT1_364_436_3.30.300.350 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;GTP-binding protein OBG, C-terminal domain 0.9824 343 412 3.30.300.350
af_Q2FXT1_359_430_3.30.300.350 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;GTP-binding protein OBG, C-terminal domain 0.9455 343 412 3.30.300.350
af_A0A144A1B2_587_658_3.30.300.350 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;GTP-binding protein OBG, C-terminal domain 0.943 343 413 3.30.300.350
af_A0A1D6F3W0_673_743_3.30.300.350 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;GTP-binding protein OBG, C-terminal domain 0.9402 347 413 3.30.300.350
ID Description Score Start End GO Terms
AF-A0A2F0BNL8-F1-model_v4 deleted 0.9194 161 322
AF-A0A645EF56-F1-model_v4 OCT domain-containing protein 0.9073 343 413 GO:0005525
AF-A0A4E9FJD5-F1-model_v4 OBG-type G domain-containing protein 0.8873 150 322 GO:0003924
GO:0005525
GO:0005739
AF-A0A661JLM2-F1-model_v4 GTPase ObgE 0.8842 150 322 GO:0003924
GO:0005525
AF-S4PHD8-F1-model_v4 GTP-binding protein 5 0.8833 150 322 GO:0003924
GO:0005525
GO:0005739

Feature Viewer

pLDDT pTM Quality
75.5 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map