F162555

General Info

Members Datasets Scaffolds Average Seq Length
135 113 270 185

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100495937|Ga0070707_1004959371
Length 210
Sequence MTTPQCGAAEQQAPIASVDRFVYSVLMKEQDQELLREPPLAGDEVSTLLGSLERQRRTFAWKCSGLDADALRATTAASSMTLGGLLKHLALVEEDYFTVRLHGRAPGPPWDSVDWEANPGWEWRSAAEDSPEELMALWTASVARSRESIAQALAGDGLDQPLKGLTDDDGNAPSLRCLLATLIEEYARHTGHADIIRESVDGLVGEDPPD

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
75 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
88 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
89 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
108 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
109 2643221613 Oerskovia sp. Root22 Isolate Unclassified
110 2643221721 Oerskovia sp. Root918 Isolate Unclassified
111 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
112 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
113 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0.74
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.93
Nodule 0
Rhizoplane 8.89
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100495937 3300005468 Unclassified 1183
2 JGI24737J22298_10155252 3300001990 Bacteria 675
3 JGI24735J21928_10030432 3300002067 Bacteria 1604
4 rootH1_10006859 3300003316 Bacteria 13246
5 rootH2_10085566 3300003320 Bacteria 5758
6 rootH1_10015530 3300003323 Bacteria 1274
7 Ga0070658_10042775 3300005327 Bacteria 3659
8 Ga0070683_100091248 3300005329 Bacteria 2860
9 Ga0068869_100041841 3300005334 Bacteria 3282
10 Ga0070680_100524673 3300005336 Bacteria 1014
11 Ga0070660_100242919 3300005339 Bacteria 1467
12 Ga0070675_101134316 3300005354 Bacteria 719
13 Ga0070681_10970725 3300005458 Bacteria 769
14 Ga0070706_100079701 3300005467 Bacteria 3031
15 Ga0070679_100007161 3300005530 Bacteria 10410
16 Ga0070665_100004296 3300005548 Bacteria 14978
17 Ga0070665_100693980 3300005548 Bacteria 1031
18 Ga0068857_100336583 3300005577 Bacteria 1396
19 Ga0068857_100339807 3300005577 Bacteria 1389
20 Ga0068861_100134128 3300005719 Bacteria 2013
21 Ga0081540_1000302 3300005983 Bacteria 50973
22 Ga0081539_10005643 3300005985 Bacteria 12580
23 Ga0081539_10007186 3300005985 Bacteria 10258
24 Ga0070717_10084703 3300006028 Bacteria 2667
25 Ga0075365_10066725 3300006038 Bacteria 2414
26 Ga0075365_10085210 3300006038 Bacteria 2146
27 Ga0075365_10163523 3300006038 Bacteria 1552
28 Ga0075363_100246903 3300006048 Bacteria 1027
29 Ga0075364_10312625 3300006051 Bacteria 1070
30 Ga0075364_10433647 3300006051 Bacteria 897
31 Ga0068865_100898972 3300006881 Bacteria 770
32 Ga0075436_100508029 3300006914 Bacteria 882
33 Ga0105245_10065670 3300009098 Bacteria 3282
34 Ga0105247_10693577 3300009101 Bacteria 766
35 Ga0114129_10000051 3300009147 Bacteria 101583
36 Ga0105243_10212741 3300009148 Bacteria 1703
37 Ga0105243_10440942 3300009148 Bacteria 1219
38 Ga0157375_10268306 3300013308 Bacteria 1868
39 Ga0157375_10292943 3300013308 Bacteria 1791
40 Ga0157375_11082732 3300013308 Bacteria 938
41 Ga0157380_10087658 3300014326 Bacteria 2559
42 Ga0182008_10008645 3300014497 Bacteria 5542
43 Ga0206353_11057402 3300020082 Bacteria 1516
44 Ga0213875_10028988 3300021388 Bacteria 2625
45 Ga0207647_10007073 3300025904 Bacteria 8138
46 Ga0207647_10031748 3300025904 Bacteria 3397
47 Ga0207705_10056023 3300025909 Bacteria 2842
48 Ga0207657_10204594 3300025919 Bacteria 1586
49 Ga0207652_10207869 3300025921 Bacteria 1762
50 Ga0207646_10423630 3300025922 Unclassified 1201
51 Ga0207659_10611988 3300025926 Bacteria 929
52 Ga0207704_11328594 3300025938 Bacteria 615
53 Ga0207691_10103091 3300025940 Bacteria 2544
54 Ga0207689_10053191 3300025942 Bacteria 3336
55 Ga0207677_10401603 3300026023 Bacteria 1162
56 Ga0207702_10764118 3300026078 Bacteria 954
57 Ga0207676_10127354 3300026095 Bacteria 2159
58 Ga0207675_100069175 3300026118 Bacteria 3300
59 Ga0207683_10339009 3300026121 Bacteria 1379
60 Ga0268266_10002654 3300028379 Bacteria 18847
61 Ga0307514_10362411 3300031649 Bacteria 765
62 Ga0316576_10019380 3300031727 Bacteria 4661
63 Ga0316578_10157879 3300031728 Bacteria 1367
64 Ga0307410_10131858 3300031852 Bacteria 1837
65 Ga0307406_10829400 3300031901 Bacteria 782
66 Ga0307416_100907414 3300032002 Bacteria 981
67 Ga0451853_3297085 3300041512 Unclassified 1358
68 Ga0466969_0012151 3300044656 Bacteria 4549
69 Ga0466966_0005130 3300044684 Bacteria 8605
70 Ga0466966_0035141 3300044684 Bacteria 3240
71 Ga0466966_0499372 3300044684 Bacteria 732
72 Ga0466961_0097226 3300044693 Bacteria 1856
73 Ga0466963_0037336 3300044694 Bacteria 3171
74 Ga0466963_0050943 3300044694 Bacteria 2742
75 Ga0466971_0230701 3300044719 Bacteria 879
76 Ga0466970_0299583 3300044765 Bacteria 907
77 Ga0466957_0004543 3300044842 Bacteria 7748
78 Ga0466959_0021290 3300045049 Bacteria 4781
79 Ga0466958_0009032 3300045836 Bacteria 5535
80 Ga0466958_0782006 3300045836 Unclassified 622
81 Ga0466967_0165331 3300045976 Bacteria 2079
82 Ga0466967_0183849 3300045976 Bacteria 1973
83 Ga0466967_0260332 3300045976 Bacteria 1660
84 Ga0466967_0508632 3300045976 Bacteria 1183
85 Ga0495603_0325802 3300046455 Bacteria 882
86 Ga0495629_0141040 3300046459 Bacteria 1677
87 Ga0495641_0094148 3300046461 Bacteria 1338
88 Ga0495606_0001366 3300046507 Bacteria 33028
89 Ga0495668_0000924 3300046616 Bacteria 32766
90 Ga0495625_0002156 3300046660 Bacteria 21891
91 Ga0495683_0052078 3300047323 Bacteria 2044
92 Ga0495593_0427161 3300047673 Bacteria 663
93 Ga0495626_0000130 3300048091 Bacteria 95069
94 Ga0496102_0453520 3300048905 Bacteria 1203
95 Ga0496103_0139025 3300048906 Bacteria 1553
96 Ga0496104_0248424 3300048907 Bacteria 1692
97 Ga0496105_0669585 3300048908 Bacteria 799
98 Ga0496109_0016187 3300048912 Bacteria 6517
99 Ga0496110_0204660 3300048913 Bacteria 1794
100 Ga0496111_0097608 3300048914 Bacteria 2157
101 Ga0496113_0138167 3300048916 Bacteria 1916
102 Ga0496114_0017561 3300048917 Bacteria 5778
103 Ga0496114_0188748 3300048917 Bacteria 1802
104 Ga0496114_0304538 3300048917 Bacteria 1407
105 Ga0496115_0211754 3300048918 Bacteria 1600
106 Ga0496118_0133694 3300048921 Bacteria 1587
107 Ga0496119_0172460 3300048922 Bacteria 1141
108 Ga0496122_0000098 3300048925 Bacteria 198547
109 Ga0496123_0000420 3300048926 Bacteria 77105
110 Ga0496124_0000179 3300048927 Bacteria 125772
111 Ga0496126_0238838 3300048929 Bacteria 1519
112 Ga0501067_0232715 3300049583 Bacteria 1025
113 Ga0501067_0517607 3300049583 Bacteria 668
114 Ga0501068_0427106 3300049584 Bacteria 856
115 Ga0501069_0234701 3300049585 Bacteria 1068
116 Ga0501070_0103602 3300049586 Bacteria 2353
117 Ga0501071_0208014 3300049587 Bacteria 1471
118 Ga0501071_0230314 3300049587 Bacteria 1396
119 Ga0501075_0088660 3300049591 Bacteria 2346
120 Ga0501076_0331105 3300049592 Bacteria 1249
121 Ga0501081_0153605 3300049743 Bacteria 1655
122 nmdc:mga0yw44_140724_c1 3300050492 Bacteria 1568
123 nmdc:mga07m45_581309_c1 3300050496 Bacteria 647
124 nmdc:mga05p37_2341_c1 3300050507 Bacteria 22040
125 nmdc:mga09592_1042816_c1 3300050508 Bacteria 682
126 nmdc:mga08x19_734678_c1 3300050514 Bacteria 701
127 Ga0495619_0063452 3300053085 Bacteria 2461
128 Ga0495619_0128780 3300053085 Bacteria 1739
129 Ga0530510_0282620 3300061734 Bacteria 1240
130 2515852994 2515154155 Bacteria 7985436
131 2644083266 2643221613 Bacteria 4622396
132 2644666450 2643221721 Bacteria 4486924
133 2887480077 2887478801 Bacteria 8972725
134 2935890954 2935890801 Bacteria 4593001
135 8001787718 8001781756 Bacteria 9586736
136 Ga0070707_100495937
137 JGI24737J22298_10155252
138 JGI24735J21928_10030432
139 rootH1_10006859
140 rootH2_10085566
141 rootH1_10015530
142 Ga0070658_10042775
143 Ga0070683_100091248
144 Ga0068869_100041841
145 Ga0070680_100524673
146 Ga0070660_100242919
147 Ga0070675_101134316
148 Ga0070681_10970725
149 Ga0070706_100079701
150 Ga0070679_100007161
151 Ga0070665_100004296
152 Ga0070665_100693980
153 Ga0068857_100336583
154 Ga0068857_100339807
155 Ga0068861_100134128
156 Ga0081540_1000302
157 Ga0081539_10005643
158 Ga0081539_10007186
159 Ga0070717_10084703
160 Ga0075365_10066725
161 Ga0075365_10085210
162 Ga0075365_10163523
163 Ga0075363_100246903
164 Ga0075364_10312625
165 Ga0075364_10433647
166 Ga0068865_100898972
167 Ga0075436_100508029
168 Ga0105245_10065670
169 Ga0105247_10693577
170 Ga0114129_10000051
171 Ga0105243_10212741
172 Ga0105243_10440942
173 Ga0157375_10268306
174 Ga0157375_10292943
175 Ga0157375_11082732
176 Ga0157380_10087658
177 Ga0182008_10008645
178 Ga0206353_11057402
179 Ga0213875_10028988
180 Ga0207647_10007073
181 Ga0207647_10031748
182 Ga0207705_10056023
183 Ga0207657_10204594
184 Ga0207652_10207869
185 Ga0207646_10423630
186 Ga0207659_10611988
187 Ga0207704_11328594
188 Ga0207691_10103091
189 Ga0207689_10053191
190 Ga0207677_10401603
191 Ga0207702_10764118
192 Ga0207676_10127354
193 Ga0207675_100069175
194 Ga0207683_10339009
195 Ga0268266_10002654
196 Ga0307514_10362411
197 Ga0316576_10019380
198 Ga0316578_10157879
199 Ga0307410_10131858
200 Ga0307406_10829400
201 Ga0307416_100907414
202 Ga0451853_3297085
203 Ga0466969_0012151
204 Ga0466966_0005130
205 Ga0466966_0035141
206 Ga0466966_0499372
207 Ga0466961_0097226
208 Ga0466963_0037336
209 Ga0466963_0050943
210 Ga0466971_0230701
211 Ga0466970_0299583
212 Ga0466957_0004543
213 Ga0466959_0021290
214 Ga0466958_0009032
215 Ga0466958_0782006
216 Ga0466967_0165331
217 Ga0466967_0183849
218 Ga0466967_0260332
219 Ga0466967_0508632
220 Ga0495603_0325802
221 Ga0495629_0141040
222 Ga0495641_0094148
223 Ga0495606_0001366
224 Ga0495668_0000924
225 Ga0495625_0002156
226 Ga0495683_0052078
227 Ga0495593_0427161
228 Ga0495626_0000130
229 Ga0496102_0453520
230 Ga0496103_0139025
231 Ga0496104_0248424
232 Ga0496105_0669585
233 Ga0496109_0016187
234 Ga0496110_0204660
235 Ga0496111_0097608
236 Ga0496113_0138167
237 Ga0496114_0017561
238 Ga0496114_0188748
239 Ga0496114_0304538
240 Ga0496115_0211754
241 Ga0496118_0133694
242 Ga0496119_0172460
243 Ga0496122_0000098
244 Ga0496123_0000420
245 Ga0496124_0000179
246 Ga0496126_0238838
247 Ga0501067_0232715
248 Ga0501067_0517607
249 Ga0501068_0427106
250 Ga0501069_0234701
251 Ga0501070_0103602
252 Ga0501071_0208014
253 Ga0501071_0230314
254 Ga0501075_0088660
255 Ga0501076_0331105
256 Ga0501081_0153605
257 nmdc:mga0yw44_140724_c1
258 nmdc:mga07m45_581309_c1
259 nmdc:mga05p37_2341_c1
260 nmdc:mga09592_1042816_c1
261 nmdc:mga08x19_734678_c1
262 Ga0495619_0063452
263 Ga0495619_0128780
264 Ga0530510_0282620
265 2515852994
266 2644083266
267 2644666450
268 2887480077
269 2935890954
270 8001787718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

47

202

0.89

PF12867

DinB_2

DinB superfamily

51

193

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7349 19 156
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.7238 19 163
2qnl-assembly1.cif.gz_A-2 crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution 0.7166 19 160
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7142 10 163
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7106 14 157
ID Description Score Start End Superfamily
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7106 14 157 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7011 19 163 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6875 14 157 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6811 13 165 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6792 12 165 1.20.120.450
ID Description Score Start End GO Terms
AF-W7SCJ6-F1-model_v4 Mini-circle protein 0.9431 7 173
AF-A0A7W7Q2Q0-F1-model_v4 Damage-inducible protein DinB 0.9366 8 173
AF-A0A7Z8JZ65-F1-model_v4 DUF664 domain-containing protein 0.9353 7 174
AF-A0A839PPS8-F1-model_v4 Damage-inducible protein DinB 0.9337 8 173
AF-A0A117P810-F1-model_v4 Mini-circle protein 0.9324 5 173

Map