F162526

General Info

Members Datasets Scaffolds Average Seq Length
135 104 127 150

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100931312|Ga0068867_1009313121
Length 170
Sequence MPIAIQLKQASIKTKMKTIEHSFGDFLITTDKTKLDIVAIHDFLSKQSGWSDNIPFDRVQTSIDNSLNFGLFHNGKQIGFARVISDFSTIAYLGDIYVLDNYRGQGLSKQLMEVVIAHPNLQGLRRWILLTSTADWLYEKYGFTKLPNPEFYMELFDPNVYKTDKQKIEK

Samples

Sample ID Description Type Environment
1 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
4 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
5 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
6 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
7 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
8 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
68 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
69 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
70 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
71 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
72 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
73 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
94 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
95 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
96 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
97 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
98 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
99 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.07
Metatranscriptomes 0
Isolates 5.93

Biome Distribution

Category Percentage (%)
Aerial Root 1.48
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10037192 3300003320 Bacteria 39592
2 rootH2_10079038 3300003320 Bacteria 7379
3 Ga0065704_10076416 3300005289 Bacteria 5130
4 Ga0065712_10350383 3300005290 Bacteria 788
5 Ga0065715_10705219 3300005293 Unclassified 651
6 Ga0070683_100000169 3300005329 Bacteria 42888
7 Ga0070683_100004413 3300005329 Bacteria 11591
8 Ga0070683_100009954 3300005329 Bacteria 8152
9 Ga0070677_10148143 3300005333 Unclassified 1089
10 Ga0070677_10252229 3300005333 Bacteria 876
11 Ga0070677_10274710 3300005333 Bacteria 846
12 Ga0070668_100157462 3300005347 Bacteria 1841
13 Ga0070669_101652885 3300005353 Bacteria 558
14 Ga0070675_100041770 3300005354 Bacteria 3746
15 Ga0070674_100471903 3300005356 Bacteria 1040
16 Ga0070673_100050089 3300005364 Bacteria 3264
17 Ga0070711_100706280 3300005439 Bacteria 849
18 Ga0070700_101068361 3300005441 Bacteria 667
19 Ga0068867_100275658 3300005459 Bacteria 1377
20 Ga0068867_100931312 3300005459 Bacteria 784
21 Ga0070684_100001463 3300005535 Bacteria 17042
22 Ga0070684_100047522 3300005535 Bacteria 3719
23 Ga0068853_100435599 3300005539 Unclassified 1231
24 Ga0070672_100036278 3300005543 Bacteria 3756
25 Ga0070672_100191901 3300005543 Unclassified 1706
26 Ga0068855_100009228 3300005563 Bacteria 11914
27 Ga0068852_100809208 3300005616 Unclassified 951
28 Ga0068863_101865593 3300005841 Bacteria 611
29 Ga0068871_100526749 3300006358 Bacteria 1068
30 Ga0075430_100006149 3300006846 Bacteria 10112
31 Ga0068865_100534845 3300006881 Bacteria 982
32 Ga0105240_10000140 3300009093 Bacteria 148591
33 Ga0105240_10000384 3300009093 Bacteria 82999
34 Ga0111539_10053031 3300009094 Unclassified 4827
35 Ga0111539_11056151 3300009094 Bacteria 944
36 Ga0111539_11703044 3300009094 Unclassified 731
37 Ga0105237_11009641 3300009545 Unclassified 839
38 Ga0105238_10028323 3300009551 Bacteria 5709
39 Ga0105239_10000890 3300010375 Bacteria 42373
40 Ga0105239_10126756 3300010375 Bacteria 2838
41 Ga0157373_10744324 3300013100 Unclassified 720
42 Ga0157369_10035945 3300013105 Bacteria 5429
43 Ga0157378_10226007 3300013297 Bacteria 1781
44 Ga0157378_10801360 3300013297 Bacteria 968
45 Ga0163162_10642749 3300013306 Bacteria 1185
46 Ga0157372_10505061 3300013307 Bacteria 1410
47 Ga0157372_11341723 3300013307 Bacteria 825
48 Ga0157375_11143148 3300013308 Bacteria 912
49 Ga0157375_11373473 3300013308 Bacteria 832
50 Ga0163163_12964909 3300014325 Bacteria 529
51 Ga0157380_10009858 3300014326 Bacteria 6857
52 Ga0157380_10015774 3300014326 Bacteria 5558
53 Ga0157380_10326037 3300014326 Bacteria 1426
54 Ga0157380_11077821 3300014326 Unclassified 841
55 Ga0182006_1047110 3300015261 Bacteria 1673
56 Ga0182006_1047387 3300015261 Bacteria 1666
57 Ga0163161_10833512 3300017792 Unclassified 777
58 Ga0207682_10017185 3300025893 Bacteria 2824
59 Ga0207695_10000027 3300025913 Bacteria 612456
60 Ga0207695_10000076 3300025913 Bacteria 307969
61 Ga0207695_10000560 3300025913 Bacteria 76436
62 Ga0207695_10000608 3300025913 Bacteria 71944
63 Ga0207681_11498052 3300025923 Bacteria 566
64 Ga0207659_10113645 3300025926 Bacteria 2063
65 Ga0207670_10209477 3300025936 Bacteria 1486
66 Ga0207669_10130259 3300025937 Bacteria 1727
67 Ga0207704_10693409 3300025938 Bacteria 842
68 Ga0207691_10171225 3300025940 Unclassified 1901
69 Ga0207661_10001321 3300025944 Bacteria 16599
70 Ga0207661_10002372 3300025944 Bacteria 12958
71 Ga0207661_10010008 3300025944 Bacteria 6814
72 Ga0207651_10943656 3300025960 Bacteria 769
73 Ga0207668_11628660 3300025972 Bacteria 583
74 Ga0207639_10282669 3300026041 Unclassified 1460
75 Ga0207641_11790977 3300026088 Bacteria 616
76 Ga0207648_10344381 3300026089 Bacteria 1343
77 Ga0207648_10632038 3300026089 Bacteria 988
78 Ga0207675_101465694 3300026118 Bacteria 703
79 Ga0207683_10193203 3300026121 Bacteria 1848
80 Ga0207698_10778234 3300026142 Unclassified 958
81 Ga0207428_10388982 3300027907 Bacteria 1022
82 Ga0268266_11896042 3300028379 Bacteria 570
83 Ga0307515_10000001 3300028794 Bacteria 4259510
84 Ga0307515_10019437 3300028794 Bacteria 12220
85 Ga0307515_10247960 3300028794 Bacteria 1539
86 Ga0316177_1066667 3300030731 Bacteria 4256
87 Ga0316176_1136225 3300030732 Bacteria 2249
88 Ga0314311_1226003 3300030733 Unclassified 869
89 Ga0316180_1018662 3300030736 Bacteria 814
90 Ga0316183_1068856 3300030742 Bacteria 6445
91 Ga0316181_1280954 3300030744 Bacteria 6095
92 Ga0316182_1451771 3300030745 Bacteria 580
93 Ga0265342_10434247 3300031712 Unclassified 675
94 Ga0316576_10110505 3300031727 Bacteria 2060
95 Ga0307405_10417902 3300031731 Unclassified 1054
96 Ga0307405_11240921 3300031731 Unclassified 646
97 Ga0307412_10000299 3300031911 Bacteria 31519
98 Ga0307416_100236519 3300032002 Bacteria 1766
99 Ga0307414_10020413 3300032004 Unclassified 4129
100 Ga0307414_10070728 3300032004 Bacteria 2514
101 Ga0316584_0174948 3300036712 Bacteria 1590
102 Ga0395905_0001276 3300037471 Bacteria 31052
103 Ga0395905_0035666 3300037471 Bacteria 4670
104 Ga0451853_3138499 3300041512 Bacteria 661
105 Ga0451577_0757447 3300042876 Bacteria 878
106 Ga0466964_0060672 3300044706 Bacteria 1573
107 Ga0495587_0040897 3300046536 Bacteria 2768
108 Ga0495680_0799934 3300047322 Bacteria 616
109 Ga0495686_0303647 3300047472 Bacteria 880
110 Ga0496115_0125357 3300048918 Bacteria 2115
111 Ga0501043_0276529 3300049579 Bacteria 1288
112 Ga0501047_0102518 3300049581 Unclassified 2741
113 Ga0501070_0009953 3300049586 Bacteria 8039
114 Ga0501073_0112664 3300049589 Bacteria 1887
115 Ga0501202_016413 3300049652 Bacteria 1437
116 Ga0501222_001964 3300049662 Bacteria 2850
117 Ga0501223_061712 3300049663 Bacteria 733
118 Ga0501240_001474 3300049673 Bacteria 2304
119 Ga0501242_000485 3300049674 Bacteria 3499
120 Ga0501259_007780 3300049688 Bacteria 1717
121 Ga0501225_0010657 3300049705 Bacteria 2601
122 Ga0501083_0025287 3300049744 Bacteria 4110
123 Ga0501241_000001 3300049758 Bacteria 233688
124 Ga0501044_0280411 3300049823 Bacteria 1600
125 nmdc:mga0qj67_24735_c1 3300050509 Bacteria 4633
126 nmdc:mga08y16_1376437_c1 3300050511 Unclassified 670
127 nmdc:mga08y16_190920_c1 3300050511 Bacteria 2125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_101068361 Ga0070700_1010683611 132
2 3300006881 Ga0068865_100534845 Ga0068865_1005348452 132
3 3300009094 Ga0111539_11056151 Ga0111539_110561512 132
4 3300014326 Ga0157380_10015774 Ga0157380_100157747 132
5 3300025937 Ga0207669_10130259 Ga0207669_101302592 132
6 3300025938 Ga0207704_10693409 Ga0207704_106934091 132
7 3300005293 Ga0065715_10705219 Ga0065715_107052191 138
8 3300005329 Ga0070683_100004413 Ga0070683_1000044136 141
9 3300005539 Ga0068853_100435599 Ga0068853_1004355992 141
10 3300005563 Ga0068855_100009228 Ga0068855_1000092289 141
11 3300005616 Ga0068852_100809208 Ga0068852_1008092081 141
12 3300010375 Ga0105239_10126756 Ga0105239_101267562 141
13 3300013100 Ga0157373_10744324 Ga0157373_107443241 141
14 3300013105 Ga0157369_10035945 Ga0157369_100359453 141
15 3300025913 Ga0207695_10000076 Ga0207695_10000076228 141
16 3300025913 Ga0207695_10000608 Ga0207695_1000060856 141
17 3300025944 Ga0207661_10002372 Ga0207661_100023729 141
18 3300026041 Ga0207639_10282669 Ga0207639_102826692 141
19 3300026142 Ga0207698_10778234 Ga0207698_107782341 141
20 3300049581 Ga0501047_0102518 Ga0501047_0102518_340_810 141
21 3300049586 Ga0501070_0009953 Ga0501070_0009953_2996_3466 141
22 iso_pu_bacteria 2919692658 2919694330 141
23 3300005289 Ga0065704_10076416 Ga0065704_100764162 142
24 3300005329 Ga0070683_100000169 Ga0070683_10000016914 142
25 3300005535 Ga0070684_100047522 Ga0070684_1000475223 142
26 3300014325 Ga0163163_12964909 Ga0163163_129649091 142
27 3300025944 Ga0207661_10001321 Ga0207661_100013219 142
28 3300009551 Ga0105238_10028323 Ga0105238_100283233 143
29 3300009545 Ga0105237_11009641 Ga0105237_110096412 144
30 3300025936 Ga0207670_10209477 Ga0207670_102094772 144
31 3300028379 Ga0268266_11896042 Ga0268266_118960421 144
32 3300032004 Ga0307414_10020413 Ga0307414_100204133 144
33 3300047472 Ga0495686_0303647 Ga0495686_0303647_52_495 144
34 iso_pu_bacteria 2842903701 2842907170 144
35 iso_pu_bacteria 2965320100 2965323787 144
36 iso_pu_bacteria 2984572630 2984575405 144
37 iso_pu_bacteria 2984606641 2984608860 144
38 3300005329 Ga0070683_100009954 Ga0070683_1000099544 145
39 3300005333 Ga0070677_10148143 Ga0070677_101481432 145
40 3300005347 Ga0070668_100157462 Ga0070668_1001574622 145
41 3300005353 Ga0070669_101652885 Ga0070669_1016528851 145
42 3300005354 Ga0070675_100041770 Ga0070675_1000417702 145
43 3300005356 Ga0070674_100471903 Ga0070674_1004719031 145
44 3300005364 Ga0070673_100050089 Ga0070673_1000500892 145
45 3300005459 Ga0068867_100275658 Ga0068867_1002756582 145
46 3300005535 Ga0070684_100001463 Ga0070684_1000014632 145
47 3300005543 Ga0070672_100036278 Ga0070672_1000362782 145
48 3300005841 Ga0068863_101865593 Ga0068863_1018655931 145
49 3300006358 Ga0068871_100526749 Ga0068871_1005267491 145
50 3300009093 Ga0105240_10000384 Ga0105240_1000038415 145
51 3300010375 Ga0105239_10000890 Ga0105239_1000089013 145
52 3300013307 Ga0157372_10505061 Ga0157372_105050612 145
53 3300013308 Ga0157375_11143148 Ga0157375_111431481 145
54 3300014326 Ga0157380_10326037 Ga0157380_103260372 145
55 3300017792 Ga0163161_10833512 Ga0163161_108335121 145
56 3300025893 Ga0207682_10017185 Ga0207682_100171852 145
57 3300025913 Ga0207695_10000027 Ga0207695_10000027264 145
58 3300025923 Ga0207681_11498052 Ga0207681_114980521 145
59 3300025926 Ga0207659_10113645 Ga0207659_101136452 145
60 3300025944 Ga0207661_10010008 Ga0207661_100100087 145
61 3300025960 Ga0207651_10943656 Ga0207651_109436562 145
62 3300026088 Ga0207641_11790977 Ga0207641_117909771 145
63 3300026089 Ga0207648_10344381 Ga0207648_103443812 145
64 3300026121 Ga0207683_10193203 Ga0207683_101932032 145
65 3300028794 Ga0307515_10000001 Ga0307515_10000001594 145
66 3300031731 Ga0307405_10417902 Ga0307405_104179021 145
67 3300031731 Ga0307405_11240921 Ga0307405_112409211 145
68 3300031911 Ga0307412_10000299 Ga0307412_100002992 145
69 3300032002 Ga0307416_100236519 Ga0307416_1002365192 145
70 3300032004 Ga0307414_10070728 Ga0307414_100707286 145
71 3300047322 Ga0495680_0799934 Ga0495680_0799934_23_460 145
72 3300049673 Ga0501240_001474 Ga0501240_001474_1278_1724 145
73 3300049758 Ga0501241_000001 Ga0501241_000001_177384_177830 145
74 3300003320 rootH2_10079038 rootH2_100790385 146
75 3300005439 Ga0070711_100706280 Ga0070711_1007062801 146
76 3300025972 Ga0207668_11628660 Ga0207668_116286601 146
77 3300028794 Ga0307515_10247960 Ga0307515_102479602 146
78 3300031712 Ga0265342_10434247 Ga0265342_104342471 146
79 3300031727 Ga0316576_10110505 Ga0316576_101105052 146
80 3300036712 Ga0316584_0174948 Ga0316584_0174948_107_565 146
81 3300037471 Ga0395905_0001276 Ga0395905_0001276_14581_15030 146
82 3300037471 Ga0395905_0035666 Ga0395905_0035666_3239_3688 146
83 3300041512 Ga0451853_3138499 Ga0451853_3138499_22_471 146
84 3300048918 Ga0496115_0125357 Ga0496115_0125357_1260_1709 146
85 3300005333 Ga0070677_10252229 Ga0070677_102522291 147
86 3300005333 Ga0070677_10274710 Ga0070677_102747101 147
87 3300006846 Ga0075430_100006149 Ga0075430_1000061497 147
88 3300009093 Ga0105240_10000140 Ga0105240_1000014074 147
89 3300013297 Ga0157378_10226007 Ga0157378_102260071 147
90 3300025913 Ga0207695_10000560 Ga0207695_1000056010 147
91 3300042876 Ga0451577_0757447 Ga0451577_0757447_112_570 147
92 3300044706 Ga0466964_0060672 Ga0466964_0060672_83_562 147
93 3300049579 Ga0501043_0276529 Ga0501043_0276529_743_1207 147
94 3300050509 nmdc:mga0qj67_24735_c1 nmdc:mga0qj67_24735_c1_1965_2420 147
95 iso_pu_bacteria 2833640130 2833642458 147
96 iso_pu_bacteria 2896317667 2896318289 147
97 iso_pu_bacteria 2904555929 2904558415 147
98 3300003320 rootH2_10037192 rootH2_100371927 148
99 3300005290 Ga0065712_10350383 Ga0065712_103503831 148
100 3300005459 Ga0068867_100931312 Ga0068867_1009313121 148
101 3300005543 Ga0070672_100191901 Ga0070672_1001919012 148
102 3300009094 Ga0111539_10053031 Ga0111539_100530314 148
103 3300009094 Ga0111539_11703044 Ga0111539_117030441 148
104 3300013297 Ga0157378_10801360 Ga0157378_108013601 148
105 3300013306 Ga0163162_10642749 Ga0163162_106427492 148
106 3300013307 Ga0157372_11341723 Ga0157372_113417231 148
107 3300013308 Ga0157375_11373473 Ga0157375_113734731 148
108 3300014326 Ga0157380_10009858 Ga0157380_100098584 148
109 3300014326 Ga0157380_11077821 Ga0157380_110778211 148
110 3300015261 Ga0182006_1047110 Ga0182006_10471102 148
111 3300015261 Ga0182006_1047387 Ga0182006_10473872 148
112 3300025940 Ga0207691_10171225 Ga0207691_101712252 148
113 3300026089 Ga0207648_10632038 Ga0207648_106320381 148
114 3300026118 Ga0207675_101465694 Ga0207675_1014656942 148
115 3300027907 Ga0207428_10388982 Ga0207428_103889821 148
116 3300028794 Ga0307515_10019437 Ga0307515_100194378 148
117 3300030731 Ga0316177_1066667 Ga0316177_10666673 148
118 3300030732 Ga0316176_1136225 Ga0316176_11362252 148
119 3300030733 Ga0314311_1226003 Ga0314311_12260032 148
120 3300030736 Ga0316180_1018662 Ga0316180_10186622 148
121 3300030742 Ga0316183_1068856 Ga0316183_10688562 148
122 3300030744 Ga0316181_1280954 Ga0316181_12809545 148
123 3300030745 Ga0316182_1451771 Ga0316182_14517712 148
124 3300046536 Ga0495587_0040897 Ga0495587_0040897_1950_2411 148
125 3300049589 Ga0501073_0112664 Ga0501073_0112664_882_1349 148
126 3300049652 Ga0501202_016413 Ga0501202_016413_592_1053 148
127 3300049662 Ga0501222_001964 Ga0501222_001964_1028_1489 148
128 3300049663 Ga0501223_061712 Ga0501223_061712_208_669 148
129 3300049674 Ga0501242_000485 Ga0501242_000485_668_1129 148
130 3300049688 Ga0501259_007780 Ga0501259_007780_733_1194 148
131 3300049705 Ga0501225_0010657 Ga0501225_0010657_1028_1489 148
132 3300049744 Ga0501083_0025287 Ga0501083_0025287_1494_1961 148
133 3300049823 Ga0501044_0280411 Ga0501044_0280411_146_613 148
134 3300050511 nmdc:mga08y16_1376437_c1 nmdc:mga08y16_1376437_c1_109_588 148
135 3300050511 nmdc:mga08y16_190920_c1 nmdc:mga08y16_190920_c1_908_1375 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

37

143

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

40

156

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

64

145

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozh-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution 0.9784 8 145
2ozh-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution 0.9448 8 145
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8404 47 98
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8373 47 98
2a4n-assembly1.cif.gz_A crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a 0.8203 9 97
ID Description Score Start End Superfamily
2ozhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9669 8 135 3.40.630.30
2ozhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9379 8 135 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9131 47 98 3.40.630.30
af_Q7XUY6_156_314_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8842 73 95 3.40.630.30
af_P9WFQ5_5_148_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8688 47 99 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1U7PUX2-F1-model_v4 Acetyltransferase (GNAT) domain-containing protein 0.9938 17 143 GO:0016747
AF-A0A2U1RQE2-F1-model_v4 deleted 0.9935 8 114
AF-A0A2V4TDP4-F1-model_v4 deleted 0.9905 9 143
AF-A0A1T4ZYI2-F1-model_v4 N-acetylglutamate synthase, GNAT family 0.99 6 145 GO:0016747
AF-A0A849HRE3-F1-model_v4 GNAT family N-acetyltransferase 0.9899 17 144 GO:0016747

Feature Viewer

pLDDT pTM Quality
91.78 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map