F161572

General Info

Members Datasets Scaffolds Average Seq Length
134 81 111 217

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2864997549|2865001731
Length 236
Sequence TKSGSNAGPYERYNKEKAALMMDARMRIIQRAVQEIKDGMVINLGIGMPTFIANEIPKDYKVMLHSENGLLGIGPYPAEDEVDPDLINAGKETVTAVPGATFFDSAESFAMIRGSHLDLAILGGMEVSENGDLANWIIPGKMVKGMGGAMDLVNGVKRILVVMEHVNKYGESKVKKECALPVTGKGVVDRLITELAVFDFTKEGMVLIETQAGVTVDEVREKTEAAFTVSASVILG

Samples

Sample ID Description Type Environment
1 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
2 2671180694 Paenibacillus sp. A3 Isolate Unclassified
3 2684623036 Frankia sp. CgIM4 Isolate Nodule
4 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
5 2738541295 Bacillus sp. OK085 Isolate Unclassified
6 2738543010 Bacillus sp. YR335 Isolate Unclassified
7 2738543017 Bacillus sp. OV186 Isolate Unclassified
8 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
9 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
10 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
11 2857586860 Bacillus sp. R-71935 Isolate Unclassified
12 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
13 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
14 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
15 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
16 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
17 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
18 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
19 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
20 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
21 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
38 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
47 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
52 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
53 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
64 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
65 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
66 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
67 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
80 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
81 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.6
Metatranscriptomes 2.24
Isolates 17.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.19
Nodule 2.24
Rhizoplane 3.73
Rhizosphere 65.67
Stem 0
Stem Tuber 0
Unclassified 17.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000302 3300003187 Bacteria 54102
2 JGI25151J46595_10112763 3300003187 Bacteria 707
3 JGI25151J46595_10112782 3300003187 Bacteria 707
4 Ga0055532_1000060 3300003758 Bacteria 150321
5 Ga0055535_1007562 3300003761 Bacteria 2059
6 Ga0055536_1004263 3300003781 Bacteria 7377
7 Ga0075429_100001486 3300006880 Bacteria 19305
8 Ga0079104_1000018 3300006946 Bacteria 271088
9 Ga0105244_10025174 3300009036 Bacteria 3238
10 Ga0105250_10000742 3300009092 Bacteria 19871
11 Ga0157371_10024272 3300013102 Bacteria 4430
12 Ga0157369_10029617 3300013105 Bacteria 6047
13 Ga0157372_10117831 3300013307 Bacteria 3046
14 Ga0157380_10021548 3300014326 Bacteria 4835
15 Ga0213873_10011251 3300021358 Bacteria 1909
16 Ga0213872_10108318 3300021361 Bacteria 1235
17 Ga0213875_10002987 3300021388 Bacteria 9848
18 Ga0213875_10022968 3300021388 Bacteria 2982
19 Ga0213871_10005808 3300021441 Bacteria 2575
20 Ga0209566_100049 3300025225 Bacteria 240746
21 Ga0209566_100739 3300025225 Bacteria 18318
22 Ga0209147_100080 3300025229 Bacteria 196308
23 Ga0209130_1021461 3300025284 Bacteria 1457
24 Ga0209676_1000427 3300025292 Bacteria 73627
25 Ga0209025_1000262 3300025294 Bacteria 123617
26 Ga0209025_1004102 3300025294 Bacteria 12975
27 Ga0209025_1004291 3300025294 Bacteria 12502
28 Ga0209025_1010928 3300025294 Bacteria 6072
29 Ga0207696_1000067 3300025711 Bacteria 228478
30 Ga0207696_1000100 3300025711 Bacteria 171029
31 Ga0209281_1000014 3300027111 Bacteria 643021
32 Ga0265334_10070090 3300028573 Bacteria 1308
33 Ga0265313_10149797 3300031595 Bacteria 998
34 Ga0265342_10108536 3300031712 Bacteria 1573
35 Ga0307416_101590050 3300032002 Bacteria 759
36 Ga0395900_0481360 3300037418 Bacteria 1194
37 Ga0436364_0598800 3300037853 Bacteria 12624
38 Ga0436364_1345664 3300037853 Bacteria 23347
39 Ga0436361_0160546 3300039447 Bacteria 4162
40 Ga0436363_0817557 3300039450 Bacteria 1737
41 Ga0436362_0209764 3300039453 Bacteria 2951
42 Ga0451577_0000014 3300042876 Bacteria 546755
43 Ga0451577_0000079 3300042876 Bacteria 219292
44 Ga0451577_0001358 3300042876 Bacteria 33020
45 Ga0451577_0001624 3300042876 Bacteria 29180
46 Ga0451577_0096931 3300042876 Bacteria 2633
47 Ga0451577_0097732 3300042876 Bacteria 2622
48 Ga0451577_0124944 3300042876 Bacteria 2305
49 Ga0451577_0180210 3300042876 Bacteria 1904
50 Ga0451577_0195477 3300042876 Bacteria 1826
51 Ga0451577_0340690 3300042876 Bacteria 1360
52 Ga0453683_0000034 3300044673 Bacteria 235218
53 Ga0453683_0000062 3300044673 Bacteria 179392
54 Ga0453683_0002610 3300044673 Bacteria 13817
55 Ga0453683_0007063 3300044673 Bacteria 7649
56 Ga0453683_0009269 3300044673 Bacteria 6577
57 Ga0453683_0009440 3300044673 Bacteria 6508
58 Ga0453683_0013150 3300044673 Bacteria 5412
59 Ga0453683_0013765 3300044673 Bacteria 5264
60 Ga0453683_0019500 3300044673 Bacteria 4342
61 Ga0453683_0024281 3300044673 Bacteria 3858
62 Ga0453683_0036996 3300044673 Bacteria 3071
63 Ga0453683_0068139 3300044673 Bacteria 2225
64 Ga0453684_0000082 3300044712 Bacteria 399380
65 Ga0453684_0000176 3300044712 Bacteria 283097
66 Ga0453684_0000594 3300044712 Bacteria 134181
67 Ga0453684_0000749 3300044712 Bacteria 113060
68 Ga0453684_0001504 3300044712 Bacteria 65595
69 Ga0453684_0033032 3300044712 Bacteria 7222
70 Ga0453684_0042207 3300044712 Bacteria 6152
71 Ga0453684_0074819 3300044712 Bacteria 4261
72 Ga0453684_0200366 3300044712 Bacteria 2327
73 Ga0453684_0215115 3300044712 Bacteria 2230
74 Ga0453684_0417538 3300044712 Bacteria 1499
75 Ga0453684_0483672 3300044712 Bacteria 1373
76 Ga0451576_0005438 3300045051 Bacteria 15974
77 Ga0451576_0028484 3300045051 Bacteria 5981
78 Ga0451576_0068520 3300045051 Bacteria 3692
79 Ga0451576_0078850 3300045051 Bacteria 3427
80 Ga0451576_0125568 3300045051 Bacteria 2674
81 Ga0451576_0219647 3300045051 Bacteria 1984
82 Ga0451576_0232326 3300045051 Bacteria 1926
83 Ga0451576_0361399 3300045051 Bacteria 1520
84 Ga0451576_0387604 3300045051 Bacteria 1465
85 Ga0451576_1510765 3300045051 Bacteria 698
86 Ga0466967_0348160 3300045976 Bacteria 1434
87 Ga0495592_0093607 3300046454 Bacteria 2152
88 Ga0495608_0048186 3300046511 Bacteria 2832
89 Ga0495628_0176283 3300046516 Bacteria 1619
90 Ga0495654_0242786 3300046530 Bacteria 753
91 Ga0495657_0044498 3300046675 Bacteria 3020
92 Ga0495599_0148839 3300046678 Bacteria 1451
93 Ga0495624_0223905 3300046690 Bacteria 1140
94 Ga0495676_0165473 3300047321 Bacteria 1561
95 Ga0495676_0202217 3300047321 Bacteria 1380
96 Ga0495684_0012435 3300047471 Bacteria 6565
97 Ga0495602_0040786 3300048088 Bacteria 4250
98 Ga0496102_0014398 3300048905 Bacteria 6872
99 Ga0496102_0240735 3300048905 Bacteria 1706
100 Ga0496107_0133781 3300048910 Bacteria 1832
101 Ga0496112_0010930 3300048915 Bacteria 8265
102 Ga0496122_0057516 3300048925 Bacteria 2887
103 Ga0496122_0188698 3300048925 Bacteria 1219
104 Ga0496124_0270631 3300048927 Bacteria 1244
105 Ga0496125_0000091 3300048928 Bacteria 212668
106 Ga0496126_0002726 3300048929 Bacteria 23341
107 Ga0501305_015776 3300049161 Bacteria 1071
108 Ga0501335_008039 3300049551 Bacteria 985
109 Ga0501336_001159 3300049552 Bacteria 1524
110 nmdc:mga09592_86339_c1 3300050508 Bacteria 2677
111 Ga0530510_0036995 3300061734 Bacteria 3517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0242786 Ga0495654_0242786_10_582 190
2 3300048925 Ga0496122_0188698 Ga0496122_0188698_44_637 197
3 3300045976 Ga0466967_0348160 Ga0466967_0348160_820_1416 198
4 3300048929 Ga0496126_0002726 Ga0496126_0002726_22200_22859 198
5 3300044673 Ga0453683_0036996 Ga0453683_0036996_722_1372 204
6 3300042876 Ga0451577_0001624 Ga0451577_0001624_14352_14975 207
7 3300044712 Ga0453684_0000176 Ga0453684_0000176_204493_205116 207
8 3300045051 Ga0451576_0078850 Ga0451576_0078850_1145_1768 207
9 3300014326 Ga0157380_10021548 Ga0157380_100215485 208
10 3300031595 Ga0265313_10149797 Ga0265313_101497972 209
11 iso_pu_bacteria 2711768156 2712468935 210
12 iso_pu_bacteria 2939573065 2939575308 210
13 iso_pu_bacteria 3000376612 3000378393 210
14 3300045051 Ga0451576_1510765 Ga0451576_1510765_26_661 211
15 iso_pu_bacteria 2868088558 2868092390 211
16 3300028573 Ga0265334_10070090 Ga0265334_100700901 212
17 3300046454 Ga0495592_0093607 Ga0495592_0093607_623_1273 212
18 3300046511 Ga0495608_0048186 Ga0495608_0048186_402_1052 212
19 3300046516 Ga0495628_0176283 Ga0495628_0176283_670_1320 212
20 3300046675 Ga0495657_0044498 Ga0495657_0044498_590_1240 212
21 3300046678 Ga0495599_0148839 Ga0495599_0148839_790_1440 212
22 3300046690 Ga0495624_0223905 Ga0495624_0223905_154_804 212
23 3300047471 Ga0495684_0012435 Ga0495684_0012435_107_757 212
24 3300048088 Ga0495602_0040786 Ga0495602_0040786_2122_2772 212
25 iso_pu_bacteria 2738541295 2738814847 212
26 iso_pu_bacteria 2738543010 2739233390 212
27 iso_pu_bacteria 8055632911 8055634422 212
28 3300042876 Ga0451577_0000079 Ga0451577_0000079_188608_189249 213
29 3300044673 Ga0453683_0068139 Ga0453683_0068139_1011_1652 213
30 3300044712 Ga0453684_0000594 Ga0453684_0000594_103339_103980 213
31 iso_pu_bacteria 2857604169 2857608427 213
32 iso_pu_bacteria 2956897341 2956899035 213
33 3300006946 Ga0079104_1000018 Ga0079104_1000018191 214
34 3300009036 Ga0105244_10025174 Ga0105244_100251743 214
35 3300009092 Ga0105250_10000742 Ga0105250_100007423 214
36 3300013105 Ga0157369_10029617 Ga0157369_100296173 214
37 3300013307 Ga0157372_10117831 Ga0157372_101178312 214
38 3300025711 Ga0207696_1000067 Ga0207696_100006730 214
39 3300025711 Ga0207696_1000100 Ga0207696_1000100110 214
40 3300027111 Ga0209281_1000014 Ga0209281_1000014431 214
41 3300044673 Ga0453683_0000034 Ga0453683_0000034_172564_173208 214
42 3300044673 Ga0453683_0000062 Ga0453683_0000062_44957_45601 214
43 3300044673 Ga0453683_0013150 Ga0453683_0013150_961_1605 214
44 3300044712 Ga0453684_0001504 Ga0453684_0001504_26761_27405 214
45 3300045051 Ga0451576_0125568 Ga0451576_0125568_656_1300 214
46 3300048925 Ga0496122_0057516 Ga0496122_0057516_2151_2801 214
47 3300048927 Ga0496124_0270631 Ga0496124_0270631_329_979 214
48 3300048928 Ga0496125_0000091 Ga0496125_0000091_57998_58648 214
49 iso_pu_bacteria 2593339131 2595091381 214
50 iso_pu_bacteria 2671180694 2673817970 214
51 iso_pu_bacteria 2684623036 2686544053 214
52 iso_pu_bacteria 2738543017 2739269067 214
53 iso_pu_bacteria 2757320391 2757566730 214
54 iso_pu_bacteria 2775507177 2777761913 214
55 iso_pu_bacteria 2775507192 2777839574 214
56 iso_pu_bacteria 2857586860 2857588014 214
57 iso_pu_bacteria 2904755435 2904756345 214
58 iso_pu_bacteria 2919414237 2919415018 214
59 iso_pu_bacteria 2936340661 2936345169 214
60 iso_pu_bacteria 3006879489 3006883342 214
61 3300032002 Ga0307416_101590050 Ga0307416_1015900501 216
62 3300044673 Ga0453683_0009269 Ga0453683_0009269_5378_6028 216
63 3300047321 Ga0495676_0165473 Ga0495676_0165473_203_853 216
64 3300048905 Ga0496102_0240735 Ga0496102_0240735_108_758 216
65 3300048910 Ga0496107_0133781 Ga0496107_0133781_648_1298 216
66 3300048915 Ga0496112_0010930 Ga0496112_0010930_2839_3489 216
67 iso_pu_bacteria 2864997549 2865001731 216
68 3300013102 Ga0157371_10024272 Ga0157371_100242724 217
69 3300031712 Ga0265342_10108536 Ga0265342_101085362 217
70 3300047321 Ga0495676_0202217 Ga0495676_0202217_380_1033 217
71 3300049161 Ga0501305_015776 Ga0501305_015776_141_794 217
72 3300049551 Ga0501335_008039 Ga0501335_008039_272_925 217
73 3300049552 Ga0501336_001159 Ga0501336_001159_295_948 217
74 3300003187 JGI25151J46595_10000302 JGI25151J46595_100003026 218
75 3300003187 JGI25151J46595_10112763 JGI25151J46595_101127631 218
76 3300003187 JGI25151J46595_10112782 JGI25151J46595_101127821 218
77 3300003758 Ga0055532_1000060 Ga0055532_100006012 218
78 3300003761 Ga0055535_1007562 Ga0055535_10075622 218
79 3300003781 Ga0055536_1004263 Ga0055536_10042635 218
80 3300006880 Ga0075429_100001486 Ga0075429_1000014865 218
81 3300021358 Ga0213873_10011251 Ga0213873_100112512 218
82 3300021361 Ga0213872_10108318 Ga0213872_101083182 218
83 3300021388 Ga0213875_10002987 Ga0213875_100029873 218
84 3300021388 Ga0213875_10022968 Ga0213875_100229681 218
85 3300021441 Ga0213871_10005808 Ga0213871_100058083 218
86 3300025225 Ga0209566_100049 Ga0209566_10004932 218
87 3300025225 Ga0209566_100739 Ga0209566_1007396 218
88 3300025229 Ga0209147_100080 Ga0209147_100080139 218
89 3300025284 Ga0209130_1021461 Ga0209130_10214612 218
90 3300025292 Ga0209676_1000427 Ga0209676_100042742 218
91 3300025294 Ga0209025_1000262 Ga0209025_1000262144 218
92 3300025294 Ga0209025_1004102 Ga0209025_10041021 218
93 3300025294 Ga0209025_1004291 Ga0209025_10042914 218
94 3300025294 Ga0209025_1010928 Ga0209025_10109282 218
95 3300037418 Ga0395900_0481360 Ga0395900_0481360_40_696 218
96 3300037853 Ga0436364_0598800 Ga0436364_0598800_2342_3016 218
97 3300037853 Ga0436364_1345664 Ga0436364_1345664_19971_20639 218
98 3300039447 Ga0436361_0160546 Ga0436361_0160546_2548_3222 218
99 3300039450 Ga0436363_0817557 Ga0436363_0817557_601_1275 218
100 3300039453 Ga0436362_0209764 Ga0436362_0209764_1517_2191 218
101 3300042876 Ga0451577_0000014 Ga0451577_0000014_301155_301811 218
102 3300042876 Ga0451577_0001358 Ga0451577_0001358_13151_13807 218
103 3300042876 Ga0451577_0096931 Ga0451577_0096931_1757_2416 218
104 3300042876 Ga0451577_0097732 Ga0451577_0097732_474_1136 218
105 3300042876 Ga0451577_0124944 Ga0451577_0124944_1560_2219 218
106 3300042876 Ga0451577_0180210 Ga0451577_0180210_64_723 218
107 3300042876 Ga0451577_0195477 Ga0451577_0195477_450_1118 218
108 3300042876 Ga0451577_0340690 Ga0451577_0340690_578_1237 218
109 3300044673 Ga0453683_0002610 Ga0453683_0002610_6011_6679 218
110 3300044673 Ga0453683_0007063 Ga0453683_0007063_5558_6214 218
111 3300044673 Ga0453683_0009440 Ga0453683_0009440_1962_2618 218
112 3300044673 Ga0453683_0013765 Ga0453683_0013765_4484_5140 218
113 3300044673 Ga0453683_0019500 Ga0453683_0019500_1843_2502 218
114 3300044673 Ga0453683_0024281 Ga0453683_0024281_3126_3785 218
115 3300044712 Ga0453684_0000082 Ga0453684_0000082_302481_303137 218
116 3300044712 Ga0453684_0000749 Ga0453684_0000749_89880_90536 218
117 3300044712 Ga0453684_0033032 Ga0453684_0033032_968_1624 218
118 3300044712 Ga0453684_0042207 Ga0453684_0042207_1739_2398 218
119 3300044712 Ga0453684_0074819 Ga0453684_0074819_479_1135 218
120 3300044712 Ga0453684_0200366 Ga0453684_0200366_741_1409 218
121 3300044712 Ga0453684_0215115 Ga0453684_0215115_131_790 218
122 3300044712 Ga0453684_0417538 Ga0453684_0417538_761_1417 218
123 3300044712 Ga0453684_0483672 Ga0453684_0483672_704_1363 218
124 3300045051 Ga0451576_0005438 Ga0451576_0005438_12326_12994 218
125 3300045051 Ga0451576_0028484 Ga0451576_0028484_2536_3192 218
126 3300045051 Ga0451576_0068520 Ga0451576_0068520_133_792 218
127 3300045051 Ga0451576_0219647 Ga0451576_0219647_387_1046 218
128 3300045051 Ga0451576_0232326 Ga0451576_0232326_1179_1835 218
129 3300045051 Ga0451576_0361399 Ga0451576_0361399_239_898 218
130 3300045051 Ga0451576_0387604 Ga0451576_0387604_215_874 218
131 3300048905 Ga0496102_0014398 Ga0496102_0014398_1594_2250 218
132 3300050508 nmdc:mga09592_86339_c1 nmdc:mga09592_86339_c1_1650_2312 218
133 3300061734 Ga0530510_0036995 Ga0530510_0036995_902_1558 218
134 iso_pu_bacteria 2919414237 2919415317 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

25

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxo-assembly3.cif.gz_F succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9249 8 211
3oxo-assembly3.cif.gz_E succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9248 8 211
3oxo-assembly4.cif.gz_H succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9229 12 211
3oxo-assembly4.cif.gz_G succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9195 8 211
3k6m-assembly2.cif.gz_C dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.9188 1 211
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8802 3 211 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8695 1 211 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8573 3 211 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8531 3 211 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8471 1 211 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A6B1GKX3-F1-model_v4 3-oxoadipate CoA-transferase 0.9229 5 211 GO:0008410
AF-A0A1I3VQR6-F1-model_v4 3-oxoacid CoA-transferase 0.9213 5 211 GO:0008410
GO:0046952
AF-A0A519H421-F1-model_v4 3-oxoacid CoA-transferase subunit A 0.917 5 210 GO:0008410
AF-A0A432KEJ8-F1-model_v4 3-oxoacid CoA-transferase subunit A 0.9165 5 211 GO:0008410
AF-A0A1Q3ZZS0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9154 9 210 GO:0008410

Feature Viewer

pLDDT pTM Quality
86.76 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map