F161373

General Info

Members Datasets Scaffolds Average Seq Length
134 105 268 141

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_25_c7|nmdc:mga06r32_25_c7_6220_6633
Length 137
Sequence VSYLLDTNVLSEWSKPRPDPGVIDWFGTAAPDELYLSVVTIGEIRRGIALLQLRGAHRKAAAFESWLAATGELFADRLVPVSVEIAQEWGAIAAANSVPMADGLIGATARVYGWTVVTRNVKDIEPTGARVLNPYTG

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
83 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
104 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
105 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 4.48
Rhizosphere 82.09
Stem 0
Stem Tuber 0
Unclassified 14.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_25_c7 3300050510 Bacteria 11552
2 JGI25405J52794_10044818 3300003911 Bacteria 940
3 Ga0070687_100423096 3300005343 Bacteria 879
4 Ga0070671_100001594 3300005355 Bacteria 17075
5 Ga0070667_100000522 3300005367 Bacteria 38608
6 Ga0070714_100399595 3300005435 Bacteria 1298
7 Ga0070711_100456254 3300005439 Bacteria 1047
8 Ga0070706_100216780 3300005467 Bacteria 1787
9 Ga0070698_100000373 3300005471 Bacteria 46692
10 Ga0070699_101302661 3300005518 Bacteria 666
11 Ga0070679_100083909 3300005530 Bacteria 3174
12 Ga0070697_101267470 3300005536 Bacteria 657
13 Ga0070665_100074327 3300005548 Bacteria 3404
14 Ga0070665_100325638 3300005548 Bacteria 1541
15 Ga0068855_100114817 3300005563 Bacteria 3087
16 Ga0068855_100838603 3300005563 Bacteria 975
17 Ga0068859_100000844 3300005617 Bacteria 31176
18 Ga0068858_100002649 3300005842 Bacteria 18024
19 Ga0081455_10002238 3300005937 Bacteria 23032
20 Ga0081455_10460659 3300005937 Unclassified 866
21 Ga0081455_10535035 3300005937 Bacteria 778
22 Ga0070717_10370569 3300006028 Bacteria 1283
23 Ga0075365_10092464 3300006038 Bacteria 2062
24 Ga0075364_10414902 3300006051 Bacteria 919
25 Ga0070712_100223910 3300006175 Bacteria 1490
26 Ga0075431_100054043 3300006847 Bacteria 4141
27 Ga0075431_100206972 3300006847 Bacteria 2006
28 Ga0097620_100000845 3300006931 Bacteria 31176
29 Ga0099794_10057948 3300007265 Unclassified 1877
30 Ga0099795_10192859 3300007788 Unclassified 856
31 Ga0099795_10337376 3300007788 Unclassified 671
32 Ga0105250_10014819 3300009092 Bacteria 3197
33 Ga0105240_10045070 3300009093 Bacteria 5597
34 Ga0105240_10229782 3300009093 Unclassified 2157
35 Ga0105240_10257364 3300009093 Bacteria 2015
36 Ga0105241_11239116 3300009174 Bacteria 708
37 Ga0105248_10046284 3300009177 Bacteria 4875
38 Ga0105237_10155340 3300009545 Bacteria 2284
39 Ga0099796_10170342 3300010159 Bacteria 868
40 Ga0105239_10189263 3300010375 Bacteria 2304
41 Ga0105239_10412670 3300010375 Bacteria 1529
42 Ga0105239_12046565 3300010375 Bacteria 665
43 Ga0157370_10481593 3300013104 Bacteria 1140
44 Ga0157372_11820019 3300013307 Bacteria 700
45 Ga0163163_10001378 3300014325 Bacteria 20520
46 Ga0157379_10002590 3300014968 Bacteria 15194
47 Ga0213872_10000492 3300021361 Bacteria 31562
48 Ga0213872_10000785 3300021361 Bacteria 23235
49 Ga0213872_10096924 3300021361 Bacteria 1317
50 Ga0213872_10244763 3300021361 Unclassified 757
51 Ga0213871_10006072 3300021441 Bacteria 2537
52 Ga0207696_1106783 3300025711 Unclassified 760
53 Ga0207710_10000399 3300025900 Bacteria 28991
54 Ga0207684_10171388 3300025910 Bacteria 1871
55 Ga0207695_10202926 3300025913 Bacteria 1896
56 Ga0207695_10360910 3300025913 Unclassified 1339
57 Ga0207671_10287843 3300025914 Bacteria 1297
58 Ga0207693_10072558 3300025915 Bacteria 2695
59 Ga0207660_10417839 3300025917 Bacteria 1081
60 Ga0207646_10919135 3300025922 Bacteria 776
61 Ga0207644_10000464 3300025931 Bacteria 26285
62 Ga0207711_10048608 3300025941 Plasmid 3629
63 Ga0207667_10046055 3300025949 Bacteria 4618
64 Ga0207667_10338835 3300025949 Bacteria 1535
65 Ga0207658_10001512 3300025986 Bacteria 18072
66 Ga0207703_10065115 3300026035 Bacteria 2994
67 Ga0207641_10039148 3300026088 Bacteria 3964
68 Ga0268266_10044201 3300028379 Plasmid 3808
69 Ga0268266_10137167 3300028379 Unclassified 2192
70 Ga0268266_10959207 3300028379 Bacteria 827
71 Ga0268264_10601258 3300028381 Bacteria 1084
72 Ga0307515_10003592 3300028794 Bacteria 32598
73 Ga0265316_10006073 3300031344 Bacteria 11591
74 Ga0307408_100536471 3300031548 Unclassified 1030
75 Ga0265313_10051114 3300031595 Bacteria 1979
76 Ga0265314_10001960 3300031711 Bacteria 21893
77 Ga0307516_10000260 3300031730 Bacteria 67580
78 Ga0307416_100538152 3300032002 Bacteria 1239
79 Ga0373936_0008636 3300035113 Bacteria 3837
80 Ga0373936_0062198 3300035113 Bacteria 1526
81 Ga0373925_0990492 3300037068 Unclassified 692
82 Ga0395898_1533973 3300037466 Unclassified 592
83 Ga0436360_0060534 3300039438 Bacteria 2972
84 Ga0436360_0351703 3300039438 Bacteria 4490
85 Ga0436360_0567802 3300039438 Bacteria 1769
86 Ga0436360_1188425 3300039438 Bacteria 939
87 Ga0436361_0047346 3300039447 Bacteria 87631
88 Ga0436361_0055709 3300039447 Bacteria 791
89 Ga0436361_0076715 3300039447 Bacteria 40178
90 Ga0436361_0174939 3300039447 Bacteria 2624
91 Ga0436361_0266063 3300039447 Unclassified 760
92 Ga0436361_0695462 3300039447 Unclassified 843
93 Ga0451789_0401511 3300041443 Unclassified 665
94 Ga0466969_0134471 3300044656 Bacteria 1145
95 Ga0466966_0014064 3300044684 Bacteria 5298
96 Ga0466963_0022204 3300044694 Bacteria 4016
97 Ga0466971_0041252 3300044719 Bacteria 2073
98 Ga0466957_0334949 3300044842 Unclassified 1024
99 Ga0466957_0350105 3300044842 Unclassified 1002
100 Ga0466958_0011143 3300045836 Bacteria 5058
101 Ga0466967_0008942 3300045976 Bacteria 7393
102 Ga0495627_047837 3300046453 Bacteria 1296
103 Ga0495580_0477983 3300046472 Unclassified 834
104 Ga0495583_0000516 3300046506 Bacteria 55187
105 Ga0495632_0000785 3300046519 Bacteria 28321
106 Ga0495643_0000251 3300046522 Bacteria 78874
107 Ga0495633_0011500 3300046558 Bacteria 4767
108 Ga0495633_0022383 3300046558 Bacteria 3146
109 Ga0495667_0009456 3300046559 Bacteria 6604
110 Ga0495671_0000023 3300046692 Bacteria 252939
111 Ga0495673_0000054 3300047469 Bacteria 252207
112 Ga0496102_0000034 3300048905 Bacteria 213826
113 Ga0496103_0000026 3300048906 Bacteria 213826
114 Ga0496105_0317084 3300048908 Bacteria 1250
115 Ga0496109_0375001 3300048912 Bacteria 1344
116 Ga0496112_0341991 3300048915 Unclassified 1439
117 Ga0496116_0000997 3300048919 Bacteria 34621
118 Ga0496117_0000072 3300048920 Bacteria 238366
119 Ga0496118_0000030 3300048921 Bacteria 339946
120 Ga0496119_0031726 3300048922 Bacteria 3535
121 Ga0496120_0025050 3300048923 Bacteria 3709
122 Ga0496121_0003846 3300048924 Bacteria 20883
123 Ga0496124_0000061 3300048927 Bacteria 238225
124 Ga0496125_0002710 3300048928 Bacteria 22504
125 Ga0496125_0028998 3300048928 Bacteria 4983
126 Ga0495678_008526 3300049459 Bacteria 5162
127 Ga0501034_0176977 3300049571 Bacteria 2099
128 Ga0501039_0539254 3300049575 Bacteria 916
129 Ga0501044_0592079 3300049823 Bacteria 1003
130 nmdc:mga00v17_708704_c1 3300050491 Bacteria 645
131 nmdc:mga0yw44_187818_c1 3300050492 Bacteria 1362
132 nmdc:mga06z11_364781_c1 3300050494 Bacteria 866
133 Ga0500559_0004863 3300053136 Bacteria 6266
134 Ga0500600_0024507 3300053149 Bacteria 3594
135 nmdc:mga06r32_25_c7
136 JGI25405J52794_10044818
137 Ga0070687_100423096
138 Ga0070671_100001594
139 Ga0070667_100000522
140 Ga0070714_100399595
141 Ga0070711_100456254
142 Ga0070706_100216780
143 Ga0070698_100000373
144 Ga0070699_101302661
145 Ga0070679_100083909
146 Ga0070697_101267470
147 Ga0070665_100074327
148 Ga0070665_100325638
149 Ga0068855_100114817
150 Ga0068855_100838603
151 Ga0068859_100000844
152 Ga0068858_100002649
153 Ga0081455_10002238
154 Ga0081455_10460659
155 Ga0081455_10535035
156 Ga0070717_10370569
157 Ga0075365_10092464
158 Ga0075364_10414902
159 Ga0070712_100223910
160 Ga0075431_100054043
161 Ga0075431_100206972
162 Ga0097620_100000845
163 Ga0099794_10057948
164 Ga0099795_10192859
165 Ga0099795_10337376
166 Ga0105250_10014819
167 Ga0105240_10045070
168 Ga0105240_10229782
169 Ga0105240_10257364
170 Ga0105241_11239116
171 Ga0105248_10046284
172 Ga0105237_10155340
173 Ga0099796_10170342
174 Ga0105239_10189263
175 Ga0105239_10412670
176 Ga0105239_12046565
177 Ga0157370_10481593
178 Ga0157372_11820019
179 Ga0163163_10001378
180 Ga0157379_10002590
181 Ga0213872_10000492
182 Ga0213872_10000785
183 Ga0213872_10096924
184 Ga0213872_10244763
185 Ga0213871_10006072
186 Ga0207696_1106783
187 Ga0207710_10000399
188 Ga0207684_10171388
189 Ga0207695_10202926
190 Ga0207695_10360910
191 Ga0207671_10287843
192 Ga0207693_10072558
193 Ga0207660_10417839
194 Ga0207646_10919135
195 Ga0207644_10000464
196 Ga0207711_10048608
197 Ga0207667_10046055
198 Ga0207667_10338835
199 Ga0207658_10001512
200 Ga0207703_10065115
201 Ga0207641_10039148
202 Ga0268266_10044201
203 Ga0268266_10137167
204 Ga0268266_10959207
205 Ga0268264_10601258
206 Ga0307515_10003592
207 Ga0265316_10006073
208 Ga0307408_100536471
209 Ga0265313_10051114
210 Ga0265314_10001960
211 Ga0307516_10000260
212 Ga0307416_100538152
213 Ga0373936_0008636
214 Ga0373936_0062198
215 Ga0373925_0990492
216 Ga0395898_1533973
217 Ga0436360_0060534
218 Ga0436360_0351703
219 Ga0436360_0567802
220 Ga0436360_1188425
221 Ga0436361_0047346
222 Ga0436361_0055709
223 Ga0436361_0076715
224 Ga0436361_0174939
225 Ga0436361_0266063
226 Ga0436361_0695462
227 Ga0451789_0401511
228 Ga0466969_0134471
229 Ga0466966_0014064
230 Ga0466963_0022204
231 Ga0466971_0041252
232 Ga0466957_0334949
233 Ga0466957_0350105
234 Ga0466958_0011143
235 Ga0466967_0008942
236 Ga0495627_047837
237 Ga0495580_0477983
238 Ga0495583_0000516
239 Ga0495632_0000785
240 Ga0495643_0000251
241 Ga0495633_0011500
242 Ga0495633_0022383
243 Ga0495667_0009456
244 Ga0495671_0000023
245 Ga0495673_0000054
246 Ga0496102_0000034
247 Ga0496103_0000026
248 Ga0496105_0317084
249 Ga0496109_0375001
250 Ga0496112_0341991
251 Ga0496116_0000997
252 Ga0496117_0000072
253 Ga0496118_0000030
254 Ga0496119_0031726
255 Ga0496120_0025050
256 Ga0496121_0003846
257 Ga0496124_0000061
258 Ga0496125_0002710
259 Ga0496125_0028998
260 Ga0495678_008526
261 Ga0501034_0176977
262 Ga0501039_0539254
263 Ga0501044_0592079
264 nmdc:mga00v17_708704_c1
265 nmdc:mga0yw44_187818_c1
266 nmdc:mga06z11_364781_c1
267 Ga0500559_0004863
268 Ga0500600_0024507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

124

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9405 2 139
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9354 2 138
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9277 2 139
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9102 2 138
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.8598 1 136
ID Description Score Start End Superfamily
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9354 2 138 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9102 2 138 3.40.50.1010
af_F1R507_266_328_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8699 82 113 1.10.8.60
af_P9WF99_2_82_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.866 2 73 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8598 1 136 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A527I003-F1-model_v4 deleted 0.9963 1 117
AF-A0A4Y3WDQ8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9926 1 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A090MVC5-F1-model_v4 Putative ribonuclease FitB 0.9922 10 138 GO:0004518
GO:0046872
AF-A0A5D3KW96-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.991 1 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A6J4IYK6-F1-model_v4 PIN domain-containing protein 0.9903 1 93 GO:0004518
GO:0046872

Map