F160848

General Info

Members Datasets Scaffolds Average Seq Length
134 82 268 164

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0197653|Ga0466967_0197653_96_698
Length 200
Sequence LQRAWSEFRRPVAVVVAVDRSGGRDLASGVCDNRPVRVYAPATTTVLRALLDTGAVGPPPVTAFAVTPGLREWYVDEDQEELEYAALSEAARASLRLLDADPDAARRRVVIATDVPDTSVSVRDDLDRGVVRVDDPIPLRAVASVHVDDADAEPTVAAAAEAIIAADLGDAGSQERVDDAEGFELSWYASQEIEALLGEL

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
25 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
82 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 2.24
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.73
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 14.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0197653 3300045976 Bacteria 1903
2 Ga0070666_10000599 3300005335 Bacteria 21663
3 Ga0070671_100070164 3300005355 Unclassified 2923
4 Ga0070667_100001058 3300005367 Bacteria 25154
5 Ga0070714_100059058 3300005435 Bacteria 3287
6 Ga0070713_100616228 3300005436 Bacteria 1032
7 Ga0070711_100391401 3300005439 Bacteria 1126
8 Ga0070663_100750193 3300005455 Bacteria 833
9 Ga0070679_100170232 3300005530 Bacteria 2151
10 Ga0070665_100005185 3300005548 Bacteria 13483
11 Ga0068856_100668033 3300005614 Unclassified 1060
12 Ga0068852_101050678 3300005616 Bacteria 834
13 Ga0068863_100002241 3300005841 Bacteria 19198
14 Ga0068858_100090261 3300005842 Unclassified 2851
15 Ga0068860_100000067 3300005843 Bacteria 180176
16 Ga0081455_10004712 3300005937 Bacteria 15161
17 Ga0081455_10444005 3300005937 Unclassified 888
18 Ga0105240_10119153 3300009093 Bacteria 3180
19 Ga0105245_10015322 3300009098 Bacteria 6681
20 Ga0105237_10079938 3300009545 Bacteria 3260
21 Ga0105237_10517570 3300009545 Bacteria 1200
22 Ga0105238_10735799 3300009551 Bacteria 1000
23 Ga0105249_11684256 3300009553 Unclassified 707
24 Ga0105239_10396936 3300010375 Bacteria 1561
25 Ga0157374_10361405 3300013296 Bacteria 1444
26 Ga0157374_11722424 3300013296 Unclassified 652
27 Ga0157379_10009145 3300014968 Bacteria 8629
28 Ga0206354_10597151 3300020081 Bacteria 1349
29 Ga0206353_11908695 3300020082 Bacteria 3913
30 Ga0224712_10000287 3300022467 Bacteria 9381
31 Ga0207680_10016287 3300025903 Unclassified 3899
32 Ga0207654_10110411 3300025911 Bacteria 1710
33 Ga0207654_10192015 3300025911 Bacteria 1339
34 Ga0207671_10062773 3300025914 Bacteria 2760
35 Ga0207671_10125097 3300025914 Bacteria 1968
36 Ga0207671_10619719 3300025914 Bacteria 862
37 Ga0207663_10337395 3300025916 Bacteria 1137
38 Ga0207652_10257845 3300025921 Bacteria 1573
39 Ga0207687_10098603 3300025927 Unclassified 2145
40 Ga0207700_10183805 3300025928 Bacteria 1752
41 Ga0207664_10206848 3300025929 Bacteria 1696
42 Ga0207644_10392936 3300025931 Unclassified 1132
43 Ga0207667_10098625 3300025949 Bacteria 3015
44 Ga0207667_10349652 3300025949 Bacteria 1508
45 Ga0207712_11147752 3300025961 Unclassified 692
46 Ga0207658_10055803 3300025986 Bacteria 2929
47 Ga0207703_10015584 3300026035 Bacteria 5929
48 Ga0207678_10072737 3300026067 Bacteria 2946
49 Ga0207702_10671370 3300026078 Unclassified 1020
50 Ga0207702_10798853 3300026078 Bacteria 932
51 Ga0207641_10008453 3300026088 Bacteria 8508
52 Ga0207698_11273663 3300026142 Bacteria 750
53 Ga0268266_10005003 3300028379 Bacteria 12519
54 Ga0268264_10000114 3300028381 Bacteria 203211
55 Ga0307515_10076929 3300028794 Bacteria 4415
56 Ga0307511_10308958 3300030521 Bacteria 708
57 Ga0265327_10107478 3300031251 Unclassified 1338
58 Ga0307415_101104421 3300032126 Bacteria 743
59 Ga0307507_10000013 3300033179 Bacteria 242708
60 Ga0373942_0184899 3300035207 Bacteria 684
61 Ga0373927_0171246 3300035695 Bacteria 1423
62 Ga0395900_0390072 3300037418 Bacteria 1359
63 Ga0395898_0451162 3300037466 Bacteria 1225
64 Ga0395901_0681478 3300038443 Bacteria 1028
65 Ga0466969_0090206 3300044656 Bacteria 1453
66 Ga0466972_0049302 3300044658 Bacteria 2034
67 Ga0466972_0089144 3300044658 Bacteria 1464
68 Ga0466972_0184627 3300044658 Unclassified 978
69 Ga0466972_0187699 3300044658 Bacteria 969
70 Ga0466966_0033959 3300044684 Bacteria 3301
71 Ga0466966_0091874 3300044684 Bacteria 1884
72 Ga0466966_0187886 3300044684 Bacteria 1252
73 Ga0466961_0004618 3300044693 Bacteria 8641
74 Ga0466961_0023702 3300044693 Bacteria 3949
75 Ga0466961_0098903 3300044693 Bacteria 1839
76 Ga0466961_0106960 3300044693 Bacteria 1761
77 Ga0466961_0116291 3300044693 Bacteria 1681
78 Ga0466961_0149611 3300044693 Bacteria 1458
79 Ga0466961_0297371 3300044693 Unclassified 986
80 Ga0466961_0438361 3300044693 Bacteria 791
81 Ga0466961_0541066 3300044693 Bacteria 702
82 Ga0466963_0016351 3300044694 Bacteria 4613
83 Ga0466963_0019127 3300044694 Bacteria 4290
84 Ga0466963_0109320 3300044694 Bacteria 1897
85 Ga0466963_0237725 3300044694 Bacteria 1277
86 Ga0466963_0267102 3300044694 Unclassified 1202
87 Ga0466963_0335936 3300044694 Bacteria 1064
88 Ga0466963_0488132 3300044694 Bacteria 870
89 Ga0466963_0627438 3300044694 Bacteria 759
90 Ga0466971_0027638 3300044719 Bacteria 2542
91 Ga0466971_0121571 3300044719 Bacteria 1209
92 Ga0466971_0399922 3300044719 Bacteria 669
93 Ga0466970_0088078 3300044765 Bacteria 1684
94 Ga0466970_0255355 3300044765 Bacteria 983
95 Ga0466957_0209172 3300044842 Bacteria 1284
96 Ga0466960_0079488 3300044901 Unclassified 1649
97 Ga0466960_0306543 3300044901 Bacteria 896
98 Ga0466959_0031452 3300045049 Bacteria 3926
99 Ga0466959_0122778 3300045049 Unclassified 1845
100 Ga0466959_0180152 3300045049 Bacteria 1478
101 Ga0466959_0283942 3300045049 Bacteria 1136
102 Ga0466959_0308844 3300045049 Unclassified 1082
103 Ga0466959_0318568 3300045049 Bacteria 1063
104 Ga0466959_0333764 3300045049 Bacteria 1035
105 Ga0466959_0344939 3300045049 Bacteria 1016
106 Ga0466959_0422631 3300045049 Bacteria 905
107 Ga0466958_0042561 3300045836 Bacteria 2735
108 Ga0466958_0042659 3300045836 Bacteria 2732
109 Ga0466958_0235933 3300045836 Bacteria 1168
110 Ga0466958_0453193 3300045836 Bacteria 831
111 Ga0466958_0493467 3300045836 Bacteria 794
112 Ga0466958_0588293 3300045836 Bacteria 724
113 Ga0466967_0007385 3300045976 Bacteria 7921
114 Ga0466967_0013555 3300045976 Bacteria 6306
115 Ga0466967_0069962 3300045976 Bacteria 3138
116 Ga0495680_0208228 3300047322 Unclassified 1400
117 Ga0496102_0000375 3300048905 Bacteria 53640
118 Ga0496102_0272079 3300048905 Bacteria 1597
119 Ga0496103_0009079 3300048906 Bacteria 5888
120 Ga0496103_0541614 3300048906 Bacteria 743
121 Ga0496110_0681030 3300048913 Bacteria 929
122 Ga0496119_0000282 3300048922 Bacteria 71403
123 Ga0496120_0001391 3300048923 Bacteria 29334
124 Ga0496125_0130425 3300048928 Bacteria 1771
125 Ga0501031_0722070 3300049568 Bacteria 639
126 Ga0501039_0281968 3300049575 Bacteria 1306
127 Ga0501040_0194198 3300049576 Bacteria 1441
128 Ga0501047_0202274 3300049581 Bacteria 1847
129 Ga0501070_0262058 3300049586 Bacteria 1413
130 Ga0501044_0016882 3300049823 Bacteria 7832
131 Ga0466962_0068802 3300061719 Bacteria 1691
132 Ga0466962_0093003 3300061719 Bacteria 1446
133 Ga0466962_0185457 3300061719 Bacteria 1015
134 2861527881 2861520306 Bacteria 8348283
135 Ga0466967_0197653
136 Ga0070666_10000599
137 Ga0070671_100070164
138 Ga0070667_100001058
139 Ga0070714_100059058
140 Ga0070713_100616228
141 Ga0070711_100391401
142 Ga0070663_100750193
143 Ga0070679_100170232
144 Ga0070665_100005185
145 Ga0068856_100668033
146 Ga0068852_101050678
147 Ga0068863_100002241
148 Ga0068858_100090261
149 Ga0068860_100000067
150 Ga0081455_10004712
151 Ga0081455_10444005
152 Ga0105240_10119153
153 Ga0105245_10015322
154 Ga0105237_10079938
155 Ga0105237_10517570
156 Ga0105238_10735799
157 Ga0105249_11684256
158 Ga0105239_10396936
159 Ga0157374_10361405
160 Ga0157374_11722424
161 Ga0157379_10009145
162 Ga0206354_10597151
163 Ga0206353_11908695
164 Ga0224712_10000287
165 Ga0207680_10016287
166 Ga0207654_10110411
167 Ga0207654_10192015
168 Ga0207671_10062773
169 Ga0207671_10125097
170 Ga0207671_10619719
171 Ga0207663_10337395
172 Ga0207652_10257845
173 Ga0207687_10098603
174 Ga0207700_10183805
175 Ga0207664_10206848
176 Ga0207644_10392936
177 Ga0207667_10098625
178 Ga0207667_10349652
179 Ga0207712_11147752
180 Ga0207658_10055803
181 Ga0207703_10015584
182 Ga0207678_10072737
183 Ga0207702_10671370
184 Ga0207702_10798853
185 Ga0207641_10008453
186 Ga0207698_11273663
187 Ga0268266_10005003
188 Ga0268264_10000114
189 Ga0307515_10076929
190 Ga0307511_10308958
191 Ga0265327_10107478
192 Ga0307415_101104421
193 Ga0307507_10000013
194 Ga0373942_0184899
195 Ga0373927_0171246
196 Ga0395900_0390072
197 Ga0395898_0451162
198 Ga0395901_0681478
199 Ga0466969_0090206
200 Ga0466972_0049302
201 Ga0466972_0089144
202 Ga0466972_0184627
203 Ga0466972_0187699
204 Ga0466966_0033959
205 Ga0466966_0091874
206 Ga0466966_0187886
207 Ga0466961_0004618
208 Ga0466961_0023702
209 Ga0466961_0098903
210 Ga0466961_0106960
211 Ga0466961_0116291
212 Ga0466961_0149611
213 Ga0466961_0297371
214 Ga0466961_0438361
215 Ga0466961_0541066
216 Ga0466963_0016351
217 Ga0466963_0019127
218 Ga0466963_0109320
219 Ga0466963_0237725
220 Ga0466963_0267102
221 Ga0466963_0335936
222 Ga0466963_0488132
223 Ga0466963_0627438
224 Ga0466971_0027638
225 Ga0466971_0121571
226 Ga0466971_0399922
227 Ga0466970_0088078
228 Ga0466970_0255355
229 Ga0466957_0209172
230 Ga0466960_0079488
231 Ga0466960_0306543
232 Ga0466959_0031452
233 Ga0466959_0122778
234 Ga0466959_0180152
235 Ga0466959_0283942
236 Ga0466959_0308844
237 Ga0466959_0318568
238 Ga0466959_0333764
239 Ga0466959_0344939
240 Ga0466959_0422631
241 Ga0466958_0042561
242 Ga0466958_0042659
243 Ga0466958_0235933
244 Ga0466958_0453193
245 Ga0466958_0493467
246 Ga0466958_0588293
247 Ga0466967_0007385
248 Ga0466967_0013555
249 Ga0466967_0069962
250 Ga0495680_0208228
251 Ga0496102_0000375
252 Ga0496102_0272079
253 Ga0496103_0009079
254 Ga0496103_0541614
255 Ga0496110_0681030
256 Ga0496119_0000282
257 Ga0496120_0001391
258 Ga0496125_0130425
259 Ga0501031_0722070
260 Ga0501039_0281968
261 Ga0501040_0194198
262 Ga0501047_0202274
263 Ga0501070_0262058
264 Ga0501044_0016882
265 Ga0466962_0068802
266 Ga0466962_0093003
267 Ga0466962_0185457
268 2861527881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21853

DUF6912

Family of unknown function (DUF6912)

36

197

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o0q-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 from caulobacter crescentus. northeast structural genomics consortium target ccr55 0.6534 1 118
2cb4-assembly1.cif.gz_A crystal structure of the catalytic domain of the mosquitocidal toxin from bacillus sphaericus, mutant e197q 0.6528 72 113
5h6k-assembly1.cif.gz_A dna targeting adp-ribosyltransferase pierisin-1 0.6465 72 112
5h6l-assembly2.cif.gz_B dna targeting adp-ribosyltransferase pierisin-1 in complex with beta-nad+ 0.6463 72 112
2o0p-assembly1.cif.gz_A x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55. 0.6416 1 118
ID Description Score Start End Superfamily
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.6629 1 118 3.20.170.20
5h6nC00 Alpha Beta;Alpha-Beta Complex;Heat-Labile Enterotoxin; Chain A;Heat-Labile Enterotoxin, subunit A 0.638 72 112 3.90.210.10
2o0pA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.6045 1 118 3.20.170.20
af_O07206_8_119_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.5913 1 113 3.20.170.20
1wfxA02 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold; 0.5468 3 110 3.20.170.30
ID Description Score Start End GO Terms
AF-A0A7W0NGW3-F1-model_v4 deleted 0.9828 1 162
AF-A0A5S5D1N7-F1-model_v4 DUF2017 domain-containing protein 0.975 2 162
AF-A0A4Z1CU21-F1-model_v4 Uncharacterized protein 0.9747 1 163
AF-A0A7W7LM28-F1-model_v4 Uncharacterized protein 0.9728 1 161
AF-G8WWG1-F1-model_v4 Uncharacterized protein 0.9726 1 162

Map