F160611

General Info

Members Datasets Scaffolds Average Seq Length
134 110 134 142

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0184524|Ga0395905_0184524_1174_1632
Length 152
Sequence VPLRPTSRDPFDLQRFVSAQEHEYDRARAELAEGCKRGHWMWYIFPQLRGLGNSELSRRYAISSLDEAKAYLQHPVLGTRLRECTRLVNGLTNRSAVEIFGSLDALKFRSCVTLFAEAGGDDDVFMAALTKYFEGEPDPLTLEKLQSAGRRF

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
67 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
70 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
84 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
87 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
88 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 2.99
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10030154 3300005327 Bacteria 4359
2 Ga0070658_10865891 3300005327 Bacteria 785
3 Ga0070680_100000113 3300005336 Bacteria 47059
4 Ga0070660_100019309 3300005339 Unclassified 4992
5 Ga0070660_100534413 3300005339 Bacteria 977
6 Ga0070671_101770370 3300005355 Unclassified 549
7 Ga0070708_100657543 3300005445 Bacteria 987
8 Ga0070681_10007263 3300005458 Bacteria 10811
9 Ga0070681_10222826 3300005458 Bacteria 1801
10 Ga0070698_100232775 3300005471 Bacteria 1776
11 Ga0070699_100815377 3300005518 Unclassified 854
12 Ga0070679_100003711 3300005530 Bacteria 13998
13 Ga0070679_100012230 3300005530 Bacteria 8198
14 Ga0070697_100372980 3300005536 Bacteria 1235
15 Ga0070697_101189463 3300005536 Unclassified 679
16 Ga0068853_100045577 3300005539 Bacteria 3756
17 Ga0068853_100072552 3300005539 Bacteria 3000
18 Ga0070696_100142142 3300005546 Bacteria 1755
19 Ga0070693_100096125 3300005547 Bacteria 1795
20 Ga0070693_100106332 3300005547 Bacteria 1718
21 Ga0068855_100020856 3300005563 Bacteria 7858
22 Ga0068855_101790517 3300005563 Bacteria 624
23 Ga0068852_100100928 3300005616 Bacteria 2605
24 Ga0068862_100393557 3300005844 Bacteria 1295
25 Ga0075364_10373811 3300006051 Bacteria 972
26 Ga0075366_10554236 3300006195 Bacteria 712
27 Ga0075434_100836424 3300006871 Unclassified 936
28 Ga0068865_100411076 3300006881 Bacteria 1110
29 Ga0105240_10000773 3300009093 Bacteria 58079
30 Ga0105240_10164323 3300009093 Bacteria 2634
31 Ga0111539_10850795 3300009094 Bacteria 1061
32 Ga0114129_10382544 3300009147 Bacteria 1858
33 Ga0105241_10000408 3300009174 Bacteria 32485
34 Ga0105241_10054978 3300009174 Bacteria 3049
35 Ga0105241_10333323 3300009174 Bacteria 1312
36 Ga0105242_10060336 3300009176 Bacteria 3116
37 Ga0105237_10199644 3300009545 Bacteria 1999
38 Ga0099796_10035700 3300010159 Bacteria 1651
39 Ga0105239_12258192 3300010375 Bacteria 633
40 Ga0157371_10186480 3300013102 Bacteria 1484
41 Ga0157371_10729381 3300013102 Bacteria 743
42 Ga0157370_10000518 3300013104 Bacteria 48217
43 Ga0157370_10009965 3300013104 Bacteria 10055
44 Ga0157369_10626556 3300013105 Bacteria 1110
45 Ga0157374_10046372 3300013296 Bacteria 4025
46 Ga0157378_10843965 3300013297 Unclassified 944
47 Ga0157372_10132073 3300013307 Bacteria 2873
48 Ga0157376_10085543 3300014969 Bacteria 2717
49 Ga0207647_10568948 3300025904 Unclassified 627
50 Ga0207705_10043463 3300025909 Bacteria 3228
51 Ga0207705_10364269 3300025909 Bacteria 1115
52 Ga0207654_10000820 3300025911 Bacteria 17120
53 Ga0207707_10000110 3300025912 Bacteria 82391
54 Ga0207695_10016191 3300025913 Bacteria 8740
55 Ga0207695_10708809 3300025913 Bacteria 887
56 Ga0207671_10280007 3300025914 Bacteria 1315
57 Ga0207663_10850881 3300025916 Bacteria 728
58 Ga0207657_10083773 3300025919 Bacteria 2674
59 Ga0207657_10141315 3300025919 Bacteria 1967
60 Ga0207652_10000265 3300025921 Bacteria 54617
61 Ga0207646_11114301 3300025922 Bacteria 694
62 Ga0207686_10032481 3300025934 Bacteria 3107
63 Ga0207704_10948812 3300025938 Bacteria 725
64 Ga0207711_10445536 3300025941 Bacteria 1205
65 Ga0207639_10076908 3300026041 Bacteria 2629
66 Ga0207648_10298018 3300026089 Bacteria 1445
67 Ga0307408_101484205 3300031548 Bacteria 641
68 Ga0307405_10721208 3300031731 Bacteria 828
69 Ga0307414_10815602 3300032004 Bacteria 852
70 Ga0307415_101933826 3300032126 Bacteria 573
71 Ga0307510_10029434 3300033180 Bacteria 6252
72 Ga0395905_0184524 3300037471 Unclassified 1958
73 Ga0395901_0010612 3300038443 Bacteria 9332
74 Ga0436363_1510391 3300039450 Bacteria 1200
75 Ga0466970_0401121 3300044765 Bacteria 782
76 Ga0495603_0052973 3300046455 Bacteria 2408
77 Ga0495629_0098951 3300046459 Bacteria 2035
78 Ga0495641_0024368 3300046461 Bacteria 2989
79 Ga0495580_0308758 3300046472 Bacteria 1076
80 Ga0495594_0123845 3300046499 Bacteria 1462
81 Ga0495606_0161326 3300046507 Unclassified 1308
82 Ga0495652_0356818 3300046529 Bacteria 1046
83 Ga0495665_0081853 3300046531 Bacteria 1697
84 Ga0495640_0146095 3300046533 Bacteria 1521
85 Ga0495621_0313881 3300046539 Bacteria 652
86 Ga0495635_0061846 3300046663 Bacteria 2571
87 Ga0495657_0009128 3300046675 Bacteria 7536
88 Ga0495647_0049581 3300046681 Bacteria 1627
89 Ga0495658_0283563 3300046683 Bacteria 1045
90 Ga0495624_0379457 3300046690 Bacteria 849
91 Ga0495581_0397844 3300047315 Bacteria 804
92 Ga0495676_0082384 3300047321 Bacteria 2435
93 Ga0495680_0294077 3300047322 Bacteria 1142
94 Ga0495593_0032031 3300047673 Bacteria 2868
95 Ga0496101_1383063 3300048904 Bacteria 549
96 Ga0496108_1201742 3300048911 Bacteria 641
97 Ga0496112_0611102 3300048915 Bacteria 1022
98 Ga0496115_1301583 3300048918 Bacteria 541
99 Ga0496118_0070079 3300048921 Bacteria 2534
100 Ga0496120_0060616 3300048923 Bacteria 2116
101 Ga0496121_0017467 3300048924 Bacteria 7328
102 Ga0496122_0006929 3300048925 Bacteria 12792
103 Ga0496123_0023906 3300048926 Bacteria 4663
104 Ga0496124_0157847 3300048927 Bacteria 1772
105 Ga0496126_0131043 3300048929 Bacteria 2167
106 Ga0501032_0001911 3300049569 Bacteria 16448
107 Ga0501033_0125894 3300049570 Bacteria 1858
108 Ga0501036_0904701 3300049572 Bacteria 724
109 Ga0501036_1400135 3300049572 Bacteria 567
110 Ga0501040_0828293 3300049576 Bacteria 670
111 Ga0501048_0170761 3300049582 Bacteria 1540
112 Ga0501068_0365048 3300049584 Bacteria 929
113 Ga0501070_0214169 3300049586 Bacteria 1581
114 Ga0501070_0378492 3300049586 Unclassified 1147
115 Ga0501071_0120610 3300049587 Bacteria 1943
116 Ga0501071_0344162 3300049587 Bacteria 1134
117 Ga0501071_0441149 3300049587 Bacteria 996
118 Ga0501072_0647008 3300049588 Bacteria 832
119 Ga0501072_0666733 3300049588 Bacteria 818
120 Ga0501075_0124337 3300049591 Bacteria 1964
121 Ga0501075_1114009 3300049591 Bacteria 599
122 Ga0501076_1028512 3300049592 Bacteria 679
123 Ga0501079_0518667 3300049741 Bacteria 937
124 Ga0501079_1089804 3300049741 Bacteria 629
125 Ga0501083_0169470 3300049744 Bacteria 1427
126 Ga0501035_0294683 3300049822 Bacteria 1368
127 Ga0501045_0217200 3300049824 Bacteria 1424
128 Ga0501045_1236754 3300049824 Bacteria 544
129 nmdc:mga09592_1129741_c1 3300050508 Bacteria 650
130 nmdc:mga0n895_1045810_c1 3300050512 Unclassified 796
131 Ga0500562_028567 3300053108 Bacteria 1466
132 Ga0501084_0384766 3300054114 Bacteria 1185
133 Ga0501082_0435168 3300060353 Bacteria 1145
134 Ga0530510_0714204 3300061734 Bacteria 764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0365048 Ga0501068_0365048_421_825 120
2 3300049744 Ga0501083_0169470 Ga0501083_0169470_452_859 121
3 3300054114 Ga0501084_0384766 Ga0501084_0384766_339_746 121
4 3300060353 Ga0501082_0435168 Ga0501082_0435168_719_1126 121
5 3300013105 Ga0157369_10626556 Ga0157369_106265562 122
6 3300049586 Ga0501070_0214169 Ga0501070_0214169_928_1362 132
7 3300049570 Ga0501033_0125894 Ga0501033_0125894_556_975 135
8 3300049572 Ga0501036_0904701 Ga0501036_0904701_59_478 135
9 3300049586 Ga0501070_0378492 Ga0501070_0378492_289_705 135
10 3300049822 Ga0501035_0294683 Ga0501035_0294683_185_604 135
11 3300009176 Ga0105242_10060336 Ga0105242_100603362 136
12 3300025934 Ga0207686_10032481 Ga0207686_100324815 136
13 3300031548 Ga0307408_101484205 Ga0307408_1014842051 136
14 3300031731 Ga0307405_10721208 Ga0307405_107212082 136
15 3300032126 Ga0307415_101933826 Ga0307415_1019338261 136
16 3300049587 Ga0501071_0344162 Ga0501071_0344162_192_614 136
17 3300049824 Ga0501045_1236754 Ga0501045_1236754_34_456 136
18 3300005536 Ga0070697_100372980 Ga0070697_1003729803 137
19 3300033180 Ga0307510_10029434 Ga0307510_100294344 137
20 3300049587 Ga0501071_0441149 Ga0501071_0441149_344_766 137
21 3300049588 Ga0501072_0666733 Ga0501072_0666733_100_531 137
22 3300049591 Ga0501075_1114009 Ga0501075_1114009_58_480 137
23 3300049592 Ga0501076_1028512 Ga0501076_1028512_53_484 137
24 3300049741 Ga0501079_0518667 Ga0501079_0518667_472_894 137
25 3300053108 Ga0500562_028567 Ga0500562_028567_182_598 137
26 3300005355 Ga0070671_101770370 Ga0070671_1017703701 138
27 3300005547 Ga0070693_100106332 Ga0070693_1001063323 138
28 3300032004 Ga0307414_10815602 Ga0307414_108156022 138
29 3300048929 Ga0496126_0131043 Ga0496126_0131043_923_1348 138
30 3300005327 Ga0070658_10030154 Ga0070658_100301542 139
31 3300005327 Ga0070658_10865891 Ga0070658_108658911 139
32 3300005336 Ga0070680_100000113 Ga0070680_10000011313 139
33 3300005339 Ga0070660_100019309 Ga0070660_1000193092 139
34 3300005339 Ga0070660_100534413 Ga0070660_1005344131 139
35 3300005445 Ga0070708_100657543 Ga0070708_1006575432 139
36 3300005458 Ga0070681_10007263 Ga0070681_100072633 139
37 3300005458 Ga0070681_10222826 Ga0070681_102228263 139
38 3300005471 Ga0070698_100232775 Ga0070698_1002327752 139
39 3300005518 Ga0070699_100815377 Ga0070699_1008153771 139
40 3300005530 Ga0070679_100003711 Ga0070679_1000037113 139
41 3300005530 Ga0070679_100012230 Ga0070679_1000122304 139
42 3300005536 Ga0070697_101189463 Ga0070697_1011894631 139
43 3300005539 Ga0068853_100045577 Ga0068853_1000455774 139
44 3300005539 Ga0068853_100072552 Ga0068853_1000725522 139
45 3300005546 Ga0070696_100142142 Ga0070696_1001421422 139
46 3300005547 Ga0070693_100096125 Ga0070693_1000961252 139
47 3300005563 Ga0068855_100020856 Ga0068855_1000208565 139
48 3300005563 Ga0068855_101790517 Ga0068855_1017905171 139
49 3300005616 Ga0068852_100100928 Ga0068852_1001009282 139
50 3300005844 Ga0068862_100393557 Ga0068862_1003935572 139
51 3300006051 Ga0075364_10373811 Ga0075364_103738112 139
52 3300006195 Ga0075366_10554236 Ga0075366_105542362 139
53 3300006871 Ga0075434_100836424 Ga0075434_1008364242 139
54 3300006881 Ga0068865_100411076 Ga0068865_1004110763 139
55 3300009093 Ga0105240_10000773 Ga0105240_1000077335 139
56 3300009093 Ga0105240_10164323 Ga0105240_101643234 139
57 3300009094 Ga0111539_10850795 Ga0111539_108507951 139
58 3300009147 Ga0114129_10382544 Ga0114129_103825443 139
59 3300009174 Ga0105241_10000408 Ga0105241_1000040818 139
60 3300009174 Ga0105241_10054978 Ga0105241_100549782 139
61 3300009174 Ga0105241_10333323 Ga0105241_103333232 139
62 3300009545 Ga0105237_10199644 Ga0105237_101996443 139
63 3300010159 Ga0099796_10035700 Ga0099796_100357002 139
64 3300010375 Ga0105239_12258192 Ga0105239_122581921 139
65 3300013102 Ga0157371_10186480 Ga0157371_101864801 139
66 3300013102 Ga0157371_10729381 Ga0157371_107293811 139
67 3300013104 Ga0157370_10000518 Ga0157370_100005184 139
68 3300013104 Ga0157370_10009965 Ga0157370_100099656 139
69 3300013296 Ga0157374_10046372 Ga0157374_100463722 139
70 3300013297 Ga0157378_10843965 Ga0157378_108439652 139
71 3300013307 Ga0157372_10132073 Ga0157372_101320733 139
72 3300014969 Ga0157376_10085543 Ga0157376_100855433 139
73 3300025904 Ga0207647_10568948 Ga0207647_105689481 139
74 3300025909 Ga0207705_10043463 Ga0207705_100434632 139
75 3300025909 Ga0207705_10364269 Ga0207705_103642692 139
76 3300025911 Ga0207654_10000820 Ga0207654_100008205 139
77 3300025912 Ga0207707_10000110 Ga0207707_1000011036 139
78 3300025913 Ga0207695_10016191 Ga0207695_100161915 139
79 3300025913 Ga0207695_10708809 Ga0207695_107088092 139
80 3300025914 Ga0207671_10280007 Ga0207671_102800072 139
81 3300025916 Ga0207663_10850881 Ga0207663_108508812 139
82 3300025919 Ga0207657_10083773 Ga0207657_100837733 139
83 3300025919 Ga0207657_10141315 Ga0207657_101413152 139
84 3300025921 Ga0207652_10000265 Ga0207652_1000026530 139
85 3300025922 Ga0207646_11114301 Ga0207646_111143011 139
86 3300025938 Ga0207704_10948812 Ga0207704_109488121 139
87 3300025941 Ga0207711_10445536 Ga0207711_104455362 139
88 3300026041 Ga0207639_10076908 Ga0207639_100769082 139
89 3300026089 Ga0207648_10298018 Ga0207648_102980182 139
90 3300037471 Ga0395905_0184524 Ga0395905_0184524_1174_1632 139
91 3300038443 Ga0395901_0010612 Ga0395901_0010612_338_796 139
92 3300039450 Ga0436363_1510391 Ga0436363_1510391_578_1003 139
93 3300044765 Ga0466970_0401121 Ga0466970_0401121_79_516 139
94 3300046455 Ga0495603_0052973 Ga0495603_0052973_1709_2140 139
95 3300046459 Ga0495629_0098951 Ga0495629_0098951_1469_1900 139
96 3300046461 Ga0495641_0024368 Ga0495641_0024368_2400_2831 139
97 3300046472 Ga0495580_0308758 Ga0495580_0308758_492_923 139
98 3300046499 Ga0495594_0123845 Ga0495594_0123845_94_525 139
99 3300046507 Ga0495606_0161326 Ga0495606_0161326_639_1094 139
100 3300046529 Ga0495652_0356818 Ga0495652_0356818_81_512 139
101 3300046531 Ga0495665_0081853 Ga0495665_0081853_134_565 139
102 3300046533 Ga0495640_0146095 Ga0495640_0146095_441_872 139
103 3300046539 Ga0495621_0313881 Ga0495621_0313881_57_479 139
104 3300046663 Ga0495635_0061846 Ga0495635_0061846_164_598 139
105 3300046675 Ga0495657_0009128 Ga0495657_0009128_4728_5162 139
106 3300046681 Ga0495647_0049581 Ga0495647_0049581_644_1075 139
107 3300046683 Ga0495658_0283563 Ga0495658_0283563_420_851 139
108 3300046690 Ga0495624_0379457 Ga0495624_0379457_406_837 139
109 3300047315 Ga0495581_0397844 Ga0495581_0397844_260_691 139
110 3300047321 Ga0495676_0082384 Ga0495676_0082384_366_797 139
111 3300047322 Ga0495680_0294077 Ga0495680_0294077_494_925 139
112 3300047673 Ga0495593_0032031 Ga0495593_0032031_958_1389 139
113 3300048904 Ga0496101_1383063 Ga0496101_1383063_47_478 139
114 3300048911 Ga0496108_1201742 Ga0496108_1201742_40_468 139
115 3300048915 Ga0496112_0611102 Ga0496112_0611102_395_838 139
116 3300048918 Ga0496115_1301583 Ga0496115_1301583_69_500 139
117 3300048921 Ga0496118_0070079 Ga0496118_0070079_770_1201 139
118 3300048923 Ga0496120_0060616 Ga0496120_0060616_775_1206 139
119 3300048924 Ga0496121_0017467 Ga0496121_0017467_4653_5084 139
120 3300048925 Ga0496122_0006929 Ga0496122_0006929_8007_8438 139
121 3300048926 Ga0496123_0023906 Ga0496123_0023906_614_1045 139
122 3300048927 Ga0496124_0157847 Ga0496124_0157847_318_749 139
123 3300049569 Ga0501032_0001911 Ga0501032_0001911_7785_8225 139
124 3300049572 Ga0501036_1400135 Ga0501036_1400135_69_488 139
125 3300049576 Ga0501040_0828293 Ga0501040_0828293_69_506 139
126 3300049582 Ga0501048_0170761 Ga0501048_0170761_872_1291 139
127 3300049587 Ga0501071_0120610 Ga0501071_0120610_1285_1704 139
128 3300049588 Ga0501072_0647008 Ga0501072_0647008_351_770 139
129 3300049591 Ga0501075_0124337 Ga0501075_0124337_1236_1655 139
130 3300049741 Ga0501079_1089804 Ga0501079_1089804_59_478 139
131 3300049824 Ga0501045_0217200 Ga0501045_0217200_442_861 139
132 3300050508 nmdc:mga09592_1129741_c1 nmdc:mga09592_1129741_c1_99_524 139
133 3300050512 nmdc:mga0n895_1045810_c1 nmdc:mga0n895_1045810_c1_203_652 139
134 3300061734 Ga0530510_0714204 Ga0530510_0714204_102_557 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

10

145

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9801 7 139
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9317 7 139
4dba-assembly2.cif.gz_D designed armadillo repeat protein (yiim3aii) 0.3899 2 137
3qky-assembly1.cif.gz_A crystal structure of rhodothermus marinus bamd 0.3894 60 135
6jqq-assembly1.cif.gz_D kate h392c from escherichia coli 0.3649 30 139
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9801 7 139 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9317 7 139 1.25.40.380
af_Q9BL64_5_344_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5446 56 130 1.25.10.10
af_O13733_259_532_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5286 59 130 1.25.10.10
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5149 11 128 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A3G7V6J7-F1-model_v4 deleted 1.009 89 138
AF-A0A4Q3DP07-F1-model_v4 DUF1810 family protein 1.005 67 138
AF-A0A3M9ND78-F1-model_v4 DUF1810 domain-containing protein 1.003 6 139
AF-A0A519PQD9-F1-model_v4 deleted 0.9979 3 132
AF-A0A4Q3JPV5-F1-model_v4 deleted 0.9972 64 138

Feature Viewer

pLDDT pTM Quality
95.62 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map