F158045

General Info

Members Datasets Scaffolds Average Seq Length
133 91 266 174

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0012075|Ga0500622_0012075_3438_4040
Length 200
Sequence LNTYRELYIFSALAGLTCKGIHVSDGVQIRRLQVIGEREIQGLSEVLIDCVEGGASVSFMLPMTMAKARAFWSKAAESAARGERMIFVAEDGSGAIVGTVQVVLDLPENQPHRGDVSKMLVHRKARRLGVGAALMTAAEQGALSAGKTVLVLDTASDDAERLYRRQGWQYSGTIPDYALMPDGAFCATHFFYKMLKPRAE

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
32 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
44 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
45 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
46 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
47 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
64 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
65 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
81 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
82 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
83 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
84 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
85 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
86 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
87 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
88 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
89 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.02
Nodule 0
Rhizoplane 2.26
Rhizosphere 83.46
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0012075 3300053156 Bacteria 4691
2 Ga0070658_10091281 3300005327 Bacteria 2510
3 Ga0068869_100652958 3300005334 Bacteria 893
4 Ga0070660_100535646 3300005339 Bacteria 976
5 Ga0070709_10159105 3300005434 Bacteria 1569
6 Ga0070710_10108210 3300005437 Bacteria 1666
7 Ga0070665_100174798 3300005548 Bacteria 2148
8 Ga0070665_100423051 3300005548 Bacteria 1341
9 Ga0068855_100308259 3300005563 Bacteria 1752
10 Ga0068860_100519173 3300005843 Unclassified 1191
11 Ga0068862_100076849 3300005844 Bacteria 2890
12 Ga0068862_100716436 3300005844 Bacteria 970
13 Ga0070717_10423539 3300006028 Bacteria 1198
14 Ga0070712_100192126 3300006175 Bacteria 1598
15 Ga0075430_100007821 3300006846 Bacteria 9033
16 Ga0075429_100000527 3300006880 Bacteria 29058
17 Ga0114129_10035109 3300009147 Bacteria 7084
18 Ga0157380_10054516 3300014326 Bacteria 3173
19 Ga0157380_10411887 3300014326 Bacteria 1286
20 Ga0157380_10498093 3300014326 Bacteria 1183
21 Ga0213876_10299038 3300021384 Bacteria 855
22 Ga0207682_10005705 3300025893 Bacteria 5047
23 Ga0207693_10163780 3300025915 Bacteria 1750
24 Ga0207663_10029708 3300025916 Bacteria 3214
25 Ga0207657_10234370 3300025919 Bacteria 1467
26 Ga0207659_11667666 3300025926 Bacteria 543
27 Ga0207664_11003258 3300025929 Bacteria 748
28 Ga0207691_10429520 3300025940 Bacteria 1125
29 Ga0207667_10145963 3300025949 Bacteria 2435
30 Ga0207641_10776448 3300026088 Bacteria 947
31 Ga0209966_1022447 3300027695 Unclassified 1234
32 Ga0209998_10029419 3300027717 Bacteria 1211
33 Ga0268266_10611794 3300028379 Bacteria 1047
34 Ga0268266_10642980 3300028379 Bacteria 1020
35 Ga0268265_11444742 3300028380 Bacteria 690
36 Ga0307513_10443527 3300031456 Unclassified 1024
37 Ga0307509_10000200 3300031507 Bacteria 95384
38 Ga0307408_100011076 3300031548 Bacteria 5955
39 Ga0307413_10905318 3300031824 Eukaryota 750
40 Ga0307410_10231314 3300031852 Bacteria 1427
41 Ga0307410_10851722 3300031852 Bacteria 778
42 Ga0307409_100075703 3300031995 Bacteria 2696
43 Ga0307409_101512825 3300031995 Bacteria 699
44 Ga0307411_11092500 3300032005 Bacteria 718
45 Ga0307415_101265515 3300032126 Bacteria 697
46 Ga0395899_0001844 3300037312 Bacteria 17542
47 Ga0395899_0322006 3300037312 Bacteria 1041
48 Ga0395900_0220359 3300037418 Bacteria 1912
49 Ga0395900_0332740 3300037418 Bacteria 1496
50 Ga0395900_1478865 3300037418 Bacteria 592
51 Ga0395898_0007015 3300037466 Bacteria 11971
52 Ga0395905_0000959 3300037471 Bacteria 37058
53 Ga0395905_0037363 3300037471 Bacteria 4560
54 Ga0395905_0140578 3300037471 Unclassified 2271
55 Ga0395905_0232544 3300037471 Bacteria 1723
56 Ga0395905_0594188 3300037471 Bacteria 1009
57 Ga0395905_1407950 3300037471 Bacteria 601
58 Ga0436365_0075922 3300039437 Bacteria 8900
59 Ga0436363_1527953 3300039450 Unclassified 725
60 Ga0451800_1514123 3300041459 Bacteria 1219
61 Ga0451802_1452156 3300041460 Unclassified 620
62 Ga0451807_0222519 3300041486 Bacteria 1690
63 Ga0451853_3401892 3300041512 Bacteria 1021
64 Ga0451853_4064682 3300041512 Bacteria 701
65 Ga0451577_0002091 3300042876 Bacteria 24573
66 Ga0466969_0022271 3300044656 Bacteria 3271
67 Ga0466969_0030117 3300044656 Bacteria 2767
68 Ga0466965_0009779 3300044683 Bacteria 4462
69 Ga0466966_0007488 3300044684 Bacteria 7228
70 Ga0466966_0043502 3300044684 Bacteria 2878
71 Ga0466966_0125342 3300044684 Bacteria 1575
72 Ga0466961_0069834 3300044693 Bacteria 2230
73 Ga0466961_0074961 3300044693 Bacteria 2145
74 Ga0466961_0086602 3300044693 Bacteria 1979
75 Ga0466964_0002145 3300044706 Bacteria 6961
76 Ga0466964_0006649 3300044706 Bacteria 4309
77 Ga0466971_0015580 3300044719 Bacteria 3348
78 Ga0466971_0315755 3300044719 Bacteria 752
79 Ga0466970_0015287 3300044765 Bacteria 3946
80 Ga0466970_0037008 3300044765 Bacteria 2586
81 Ga0466957_0033576 3300044842 Bacteria 3078
82 Ga0466957_0129143 3300044842 Bacteria 1617
83 Ga0466960_0187755 3300044901 Bacteria 1123
84 Ga0466959_0033647 3300045049 Bacteria 3790
85 Ga0466959_0076219 3300045049 Bacteria 2422
86 Ga0466959_0114940 3300045049 Bacteria 1917
87 Ga0466959_0308030 3300045049 Unclassified 1084
88 Ga0451576_0000534 3300045051 Bacteria 81922
89 Ga0466958_0081741 3300045836 Bacteria 1988
90 Ga0466958_0337348 3300045836 Bacteria 970
91 Ga0466967_0001753 3300045976 Bacteria 12956
92 Ga0466967_0066300 3300045976 Bacteria 3216
93 Ga0466967_0142318 3300045976 Bacteria 2235
94 Ga0495652_0968845 3300046529 Bacteria 558
95 Ga0495668_0338353 3300046616 Bacteria 826
96 Ga0495625_0082545 3300046660 Bacteria 2235
97 Ga0495686_0111916 3300047472 Bacteria 1636
98 Ga0501032_0003215 3300049569 Bacteria 12563
99 Ga0501034_0223101 3300049571 Bacteria 1836
100 Ga0501034_0353525 3300049571 Bacteria 1397
101 Ga0501036_0111141 3300049572 Bacteria 2316
102 Ga0501037_0154162 3300049573 Bacteria 1641
103 Ga0501038_0077421 3300049574 Bacteria 2808
104 Ga0501043_0060046 3300049579 Bacteria 2984
105 Ga0501043_0685822 3300049579 Bacteria 749
106 Ga0501046_0002658 3300049580 Bacteria 16678
107 Ga0501046_0005532 3300049580 Bacteria 11284
108 Ga0501046_0031247 3300049580 Bacteria 4319
109 Ga0501046_0100764 3300049580 Bacteria 2216
110 Ga0501047_0057171 3300049581 Bacteria 3772
111 Ga0501067_0362432 3300049583 Bacteria 808
112 Ga0501072_0409177 3300049588 Bacteria 1076
113 Ga0501035_0009550 3300049822 Bacteria 9020
114 Ga0501035_0357308 3300049822 Bacteria 1221
115 Ga0501044_0000402 3300049823 Bacteria 53402
116 Ga0501044_0339083 3300049823 Bacteria 1424
117 nmdc:mga05p37_6252_c1 3300050507 Bacteria 14024
118 nmdc:mga09592_2128_c1 3300050508 Bacteria 15997
119 nmdc:mga0qj67_16615_c1 3300050509 Bacteria 5585
120 nmdc:mga0sz30_539573_c1 3300050516 Bacteria 526
121 Ga0500643_087823 3300053087 Bacteria 850
122 Ga0500646_0004149 3300053090 Unclassified 3678
123 Ga0500562_136013 3300053108 Bacteria 670
124 Ga0500594_0191481 3300053118 Bacteria 670
125 Ga0500658_0122293 3300053134 Bacteria 1155
126 Ga0500568_0022771 3300053139 Bacteria 2673
127 Ga0500568_0041544 3300053139 Bacteria 1847
128 Ga0500568_0072425 3300053139 Bacteria 1317
129 Ga0500616_0020258 3300053153 Bacteria 3738
130 Ga0500622_0000461 3300053156 Bacteria 38582
131 Ga0501082_0363959 3300060353 Bacteria 1261
132 Ga0466962_0001079 3300061719 Bacteria 12526
133 Ga0466962_0244301 3300061719 Bacteria 881
134 Ga0500622_0012075
135 Ga0070658_10091281
136 Ga0068869_100652958
137 Ga0070660_100535646
138 Ga0070709_10159105
139 Ga0070710_10108210
140 Ga0070665_100174798
141 Ga0070665_100423051
142 Ga0068855_100308259
143 Ga0068860_100519173
144 Ga0068862_100076849
145 Ga0068862_100716436
146 Ga0070717_10423539
147 Ga0070712_100192126
148 Ga0075430_100007821
149 Ga0075429_100000527
150 Ga0114129_10035109
151 Ga0157380_10054516
152 Ga0157380_10411887
153 Ga0157380_10498093
154 Ga0213876_10299038
155 Ga0207682_10005705
156 Ga0207693_10163780
157 Ga0207663_10029708
158 Ga0207657_10234370
159 Ga0207659_11667666
160 Ga0207664_11003258
161 Ga0207691_10429520
162 Ga0207667_10145963
163 Ga0207641_10776448
164 Ga0209966_1022447
165 Ga0209998_10029419
166 Ga0268266_10611794
167 Ga0268266_10642980
168 Ga0268265_11444742
169 Ga0307513_10443527
170 Ga0307509_10000200
171 Ga0307408_100011076
172 Ga0307413_10905318
173 Ga0307410_10231314
174 Ga0307410_10851722
175 Ga0307409_100075703
176 Ga0307409_101512825
177 Ga0307411_11092500
178 Ga0307415_101265515
179 Ga0395899_0001844
180 Ga0395899_0322006
181 Ga0395900_0220359
182 Ga0395900_0332740
183 Ga0395900_1478865
184 Ga0395898_0007015
185 Ga0395905_0000959
186 Ga0395905_0037363
187 Ga0395905_0140578
188 Ga0395905_0232544
189 Ga0395905_0594188
190 Ga0395905_1407950
191 Ga0436365_0075922
192 Ga0436363_1527953
193 Ga0451800_1514123
194 Ga0451802_1452156
195 Ga0451807_0222519
196 Ga0451853_3401892
197 Ga0451853_4064682
198 Ga0451577_0002091
199 Ga0466969_0022271
200 Ga0466969_0030117
201 Ga0466965_0009779
202 Ga0466966_0007488
203 Ga0466966_0043502
204 Ga0466966_0125342
205 Ga0466961_0069834
206 Ga0466961_0074961
207 Ga0466961_0086602
208 Ga0466964_0002145
209 Ga0466964_0006649
210 Ga0466971_0015580
211 Ga0466971_0315755
212 Ga0466970_0015287
213 Ga0466970_0037008
214 Ga0466957_0033576
215 Ga0466957_0129143
216 Ga0466960_0187755
217 Ga0466959_0033647
218 Ga0466959_0076219
219 Ga0466959_0114940
220 Ga0466959_0308030
221 Ga0451576_0000534
222 Ga0466958_0081741
223 Ga0466958_0337348
224 Ga0466967_0001753
225 Ga0466967_0066300
226 Ga0466967_0142318
227 Ga0495652_0968845
228 Ga0495668_0338353
229 Ga0495625_0082545
230 Ga0495686_0111916
231 Ga0501032_0003215
232 Ga0501034_0223101
233 Ga0501034_0353525
234 Ga0501036_0111141
235 Ga0501037_0154162
236 Ga0501038_0077421
237 Ga0501043_0060046
238 Ga0501043_0685822
239 Ga0501046_0002658
240 Ga0501046_0005532
241 Ga0501046_0031247
242 Ga0501046_0100764
243 Ga0501047_0057171
244 Ga0501067_0362432
245 Ga0501072_0409177
246 Ga0501035_0009550
247 Ga0501035_0357308
248 Ga0501044_0000402
249 Ga0501044_0339083
250 nmdc:mga05p37_6252_c1
251 nmdc:mga09592_2128_c1
252 nmdc:mga0qj67_16615_c1
253 nmdc:mga0sz30_539573_c1
254 Ga0500643_087823
255 Ga0500646_0004149
256 Ga0500562_136013
257 Ga0500594_0191481
258 Ga0500658_0122293
259 Ga0500568_0022771
260 Ga0500568_0041544
261 Ga0500568_0072425
262 Ga0500616_0020258
263 Ga0500622_0000461
264 Ga0501082_0363959
265 Ga0466962_0001079
266 Ga0466962_0244301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

58

168

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

82

170

0.8

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

62

174

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9519 1 168
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9411 1 168
2j8n-assembly1.cif.gz_A structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature 0.8756 2 168
1yvo-assembly1.cif.gz_A hypothetical acetyltransferase from p.aeruginosa pa01 0.849 2 168
2ge3-assembly1.cif.gz_B crystal structure of probable acetyltransferase from agrobacterium tumefaciens 0.8446 2 166
ID Description Score Start End Superfamily
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.927 8 169 3.40.630.30
af_Q54KJ7_19_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9092 6 169 3.40.630.30
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9 1 168 3.40.630.30
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8949 1 168 3.40.630.30
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8903 8 169 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A5C7RJF5-F1-model_v4 GNAT family N-acetyltransferase 0.9824 2 164 GO:0016747
AF-A0A4V2R6F0-F1-model_v4 deleted 0.9813 2 169
AF-A0A2V6WL09-F1-model_v4 GNAT family N-acetyltransferase 0.9813 3 168 GO:0016747
AF-A0A829YLX6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9806 2 169 GO:0016747
AF-A0A6L6Q6F0-F1-model_v4 GNAT family N-acetyltransferase 0.9805 2 169 GO:0016747

Map