F155912

General Info

Members Datasets Scaffolds Average Seq Length
133 66 266 211

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10316229|Ga0075366_103162292
Length 218
Sequence MIDIAVVDYGMGNLRSVSKALEHVAPDKSVLVTSDPDQIAAAGRVVFPGQGAMPDCVRELDARGLRDAVIAAAASKPFLGICIGLQLLFDHSEEGNAAGLGIFPGNVKRFAPQDMHDAEGNKLKVPHMGWNQVYQSQSQAKTHPLWAGIEDGSRFYYVHSYYVDPVDTTLVAGYSEYPSRFTSCVARDNIFAVQFHPEKSQHAGLQLLSNFVLWDGHP

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
4 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
5 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
6 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
7 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
8 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
9 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
10 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
12 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
16 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
17 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
18 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
19 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
20 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
21 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
22 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
23 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
24 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
25 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
26 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
27 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
28 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
29 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
30 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
31 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
34 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
35 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
36 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
40 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
41 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
42 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
43 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
44 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
45 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
47 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
48 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
49 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
56 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
57 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
58 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
60 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
61 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
62 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
63 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
64 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
65 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
66 2547132512 Azospira oryzae 6a3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 3.76
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0.75
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10316229 3300006195 Bacteria 956
2 Ga0065715_10034878 3300005293 Bacteria 1609
3 Ga0070697_100284121 3300005536 Bacteria 1420
4 Ga0070695_100252078 3300005545 Bacteria 1285
5 Ga0070693_100003349 3300005547 Bacteria 7451
6 Ga0070716_100013600 3300006173 Bacteria 4151
7 Ga0070716_100434187 3300006173 Bacteria 953
8 Ga0075430_100280690 3300006846 Bacteria 1378
9 Ga0075433_10086817 3300006852 Bacteria 2763
10 Ga0099794_10108038 3300007265 Bacteria 1392
11 Ga0099794_10142945 3300007265 Bacteria 1212
12 Ga0114129_10390498 3300009147 Bacteria 1836
13 Ga0157374_10530486 3300013296 Bacteria 1184
14 Ga0207665_10032441 3300025939 Bacteria 3458
15 Ga0207676_10502954 3300026095 Bacteria 1151
16 Ga0209179_1004916 3300027512 Bacteria 2055
17 Ga0265326_10002766 3300028558 Bacteria 5879
18 Ga0265318_10020546 3300028577 Bacteria 2664
19 Ga0265318_10104896 3300028577 Bacteria 1040
20 Ga0265323_10001302 3300028653 Bacteria 12445
21 Ga0265323_10002297 3300028653 Bacteria 8855
22 Ga0265323_10004822 3300028653 Bacteria 5778
23 Ga0265322_10067248 3300028654 Bacteria 1016
24 Ga0265338_10006883 3300028800 Bacteria 14314
25 Ga0265330_10000400 3300031235 Bacteria 29946
26 Ga0265330_10003615 3300031235 Bacteria 8050
27 Ga0265330_10004223 3300031235 Bacteria 7327
28 Ga0265330_10038420 3300031235 Bacteria 2128
29 Ga0265332_10000058 3300031238 Bacteria 102565
30 Ga0265325_10019797 3300031241 Bacteria 3716
31 Ga0265329_10000243 3300031242 Bacteria 29090
32 Ga0265339_10091013 3300031249 Bacteria 1599
33 Ga0265339_10156680 3300031249 Bacteria 1148
34 Ga0265316_10000068 3300031344 Bacteria 108687
35 Ga0265316_10000410 3300031344 Bacteria 48968
36 Ga0265316_10002538 3300031344 Bacteria 18866
37 Ga0265316_10021722 3300031344 Bacteria 5429
38 Ga0265316_10028898 3300031344 Bacteria 4566
39 Ga0265316_10152482 3300031344 Bacteria 1731
40 Ga0265316_10160297 3300031344 Bacteria 1682
41 Ga0265316_10234201 3300031344 Bacteria 1351
42 Ga0307408_100426120 3300031548 Bacteria 1145
43 Ga0316575_10001586 3300031665 Bacteria 7394
44 Ga0316579_10003552 3300031691 Bacteria 6102
45 Ga0316579_10006383 3300031691 Bacteria 4814
46 Ga0316579_10007532 3300031691 Bacteria 4501
47 Ga0316579_10063699 3300031691 Bacteria 1738
48 Ga0316579_10213861 3300031691 Bacteria 932
49 Ga0265342_10001267 3300031712 Bacteria 23781
50 Ga0265342_10039271 3300031712 Bacteria 2877
51 Ga0265342_10058297 3300031712 Bacteria 2282
52 Ga0265342_10086901 3300031712 Unclassified 1797
53 Ga0265342_10160841 3300031712 Bacteria 1241
54 Ga0316576_10026824 3300031727 Bacteria 4046
55 Ga0316576_10041941 3300031727 Bacteria 3297
56 Ga0316576_10047754 3300031727 Bacteria 3103
57 Ga0316576_10049708 3300031727 Bacteria 3046
58 Ga0316576_10106463 3300031727 Bacteria 2100
59 Ga0316576_10176606 3300031727 Bacteria 1611
60 Ga0316576_10218823 3300031727 Bacteria 1433
61 Ga0316576_10431449 3300031727 Bacteria 974
62 Ga0316578_10019153 3300031728 Bacteria 3761
63 Ga0316578_10025746 3300031728 Bacteria 3310
64 Ga0316578_10065841 3300031728 Bacteria 2140
65 Ga0316578_10137293 3300031728 Bacteria 1472
66 Ga0316578_10244101 3300031728 Bacteria 1078
67 Ga0316577_10011728 3300031733 Bacteria 4754
68 Ga0316577_10045369 3300031733 Bacteria 2456
69 Ga0316577_10081074 3300031733 Bacteria 1814
70 Ga0316583_10002919 3300032133 Bacteria 6005
71 Ga0316583_10004187 3300032133 Bacteria 5130
72 Ga0316583_10019781 3300032133 Bacteria 2414
73 Ga0316585_10004348 3300032137 Bacteria 3940
74 Ga0316580_10024248 3300032139 Bacteria 1874
75 Ga0316580_10059467 3300032139 Bacteria 1174
76 Ga0316593_10000448 3300032168 Bacteria 7518
77 Ga0316593_10001558 3300032168 Bacteria 5101
78 Ga0316593_10008065 3300032168 Bacteria 2922
79 Ga0316588_1073254 3300033528 Bacteria 843
80 Ga0316596_1009386 3300033541 Bacteria 2347
81 Ga0373952_0000149 3300035092 Bacteria 10342
82 Ga0373942_0006992 3300035207 Bacteria 2608
83 Ga0316574_0001173 3300035398 Bacteria 12116
84 Ga0316574_0030126 3300035398 Bacteria 3284
85 Ga0316574_0109897 3300035398 Bacteria 1767
86 Ga0316574_0123381 3300035398 Bacteria 1664
87 Ga0316574_0171396 3300035398 Bacteria 1397
88 Ga0316574_0354768 3300035398 Bacteria 927
89 Ga0373927_0319335 3300035695 Bacteria 1023
90 Ga0316582_0003131 3300036647 Bacteria 8016
91 Ga0316582_0023391 3300036647 Bacteria 3682
92 Ga0316582_0072467 3300036647 Bacteria 2233
93 Ga0316582_0121290 3300036647 Bacteria 1749
94 Ga0316582_0177873 3300036647 Bacteria 1446
95 Ga0316582_0224107 3300036647 Bacteria 1286
96 Ga0316582_0325646 3300036647 Bacteria 1057
97 Ga0316582_0607569 3300036647 Bacteria 753
98 Ga0316584_0024789 3300036712 Bacteria 4393
99 Ga0316584_0029810 3300036712 Bacteria 4028
100 Ga0316584_0046328 3300036712 Bacteria 3247
101 Ga0316584_0046878 3300036712 Bacteria 3228
102 Ga0316584_0056422 3300036712 Bacteria 2940
103 Ga0316584_0117345 3300036712 Bacteria 1990
104 Ga0316584_0324561 3300036712 Bacteria 1110
105 Ga0316584_0382838 3300036712 Bacteria 1005
106 Ga0373925_0038469 3300037068 Bacteria 3537
107 Ga0316581_0002870 3300037588 Bacteria 4219
108 Ga0316581_0003275 3300037588 Bacteria 4015
109 Ga0316581_0021087 3300037588 Bacteria 1912
110 Ga0400484_17040 3300038725 Bacteria 1017
111 Ga0242420_044900 3300038996 Bacteria 852
112 Ga0400487_10797 3300039110 Bacteria 8711
113 Ga0436365_0503098 3300039437 Bacteria 942
114 Ga0451577_0191211 3300042876 Bacteria 1846
115 Ga0453683_0095539 3300044673 Bacteria 1865
116 Ga0453684_0002459 3300044712 Bacteria 44922
117 Ga0453684_0012504 3300044712 Bacteria 13978
118 Ga0453684_0134345 3300044712 Bacteria 2964
119 Ga0453684_0351492 3300044712 Bacteria 1662
120 Ga0451576_0615914 3300045051 Bacteria 1141
121 Ga0495668_0098619 3300046616 Bacteria 1599
122 Ga0495668_0148236 3300046616 Bacteria 1285
123 Ga0495636_0098935 3300047318 Bacteria 1273
124 Ga0496112_0230485 3300048915 Bacteria 1807
125 Ga0501038_0065687 3300049574 Bacteria 3090
126 Ga0501070_0067442 3300049586 Bacteria 2963
127 Ga0501073_0008004 3300049589 Bacteria 7848
128 Ga0501080_0058429 3300049742 Bacteria 3590
129 Ga0501083_0095460 3300049744 Bacteria 1962
130 nmdc:mga0n895_249738_c1 3300050512 Bacteria 1800
131 nmdc:mga08x19_43525_c1 3300050514 Bacteria 2865
132 nmdc:mga0a205_131725_c1 3300050515 Bacteria 2400
133 2548848698 2547132512 Bacteria 3416496
134 Ga0075366_10316229
135 Ga0065715_10034878
136 Ga0070697_100284121
137 Ga0070695_100252078
138 Ga0070693_100003349
139 Ga0070716_100013600
140 Ga0070716_100434187
141 Ga0075430_100280690
142 Ga0075433_10086817
143 Ga0099794_10108038
144 Ga0099794_10142945
145 Ga0114129_10390498
146 Ga0157374_10530486
147 Ga0207665_10032441
148 Ga0207676_10502954
149 Ga0209179_1004916
150 Ga0265326_10002766
151 Ga0265318_10020546
152 Ga0265318_10104896
153 Ga0265323_10001302
154 Ga0265323_10002297
155 Ga0265323_10004822
156 Ga0265322_10067248
157 Ga0265338_10006883
158 Ga0265330_10000400
159 Ga0265330_10003615
160 Ga0265330_10004223
161 Ga0265330_10038420
162 Ga0265332_10000058
163 Ga0265325_10019797
164 Ga0265329_10000243
165 Ga0265339_10091013
166 Ga0265339_10156680
167 Ga0265316_10000068
168 Ga0265316_10000410
169 Ga0265316_10002538
170 Ga0265316_10021722
171 Ga0265316_10028898
172 Ga0265316_10152482
173 Ga0265316_10160297
174 Ga0265316_10234201
175 Ga0307408_100426120
176 Ga0316575_10001586
177 Ga0316579_10003552
178 Ga0316579_10006383
179 Ga0316579_10007532
180 Ga0316579_10063699
181 Ga0316579_10213861
182 Ga0265342_10001267
183 Ga0265342_10039271
184 Ga0265342_10058297
185 Ga0265342_10086901
186 Ga0265342_10160841
187 Ga0316576_10026824
188 Ga0316576_10041941
189 Ga0316576_10047754
190 Ga0316576_10049708
191 Ga0316576_10106463
192 Ga0316576_10176606
193 Ga0316576_10218823
194 Ga0316576_10431449
195 Ga0316578_10019153
196 Ga0316578_10025746
197 Ga0316578_10065841
198 Ga0316578_10137293
199 Ga0316578_10244101
200 Ga0316577_10011728
201 Ga0316577_10045369
202 Ga0316577_10081074
203 Ga0316583_10002919
204 Ga0316583_10004187
205 Ga0316583_10019781
206 Ga0316585_10004348
207 Ga0316580_10024248
208 Ga0316580_10059467
209 Ga0316593_10000448
210 Ga0316593_10001558
211 Ga0316593_10008065
212 Ga0316588_1073254
213 Ga0316596_1009386
214 Ga0373952_0000149
215 Ga0373942_0006992
216 Ga0316574_0001173
217 Ga0316574_0030126
218 Ga0316574_0109897
219 Ga0316574_0123381
220 Ga0316574_0171396
221 Ga0316574_0354768
222 Ga0373927_0319335
223 Ga0316582_0003131
224 Ga0316582_0023391
225 Ga0316582_0072467
226 Ga0316582_0121290
227 Ga0316582_0177873
228 Ga0316582_0224107
229 Ga0316582_0325646
230 Ga0316582_0607569
231 Ga0316584_0024789
232 Ga0316584_0029810
233 Ga0316584_0046328
234 Ga0316584_0046878
235 Ga0316584_0056422
236 Ga0316584_0117345
237 Ga0316584_0324561
238 Ga0316584_0382838
239 Ga0373925_0038469
240 Ga0316581_0002870
241 Ga0316581_0003275
242 Ga0316581_0021087
243 Ga0400484_17040
244 Ga0242420_044900
245 Ga0400487_10797
246 Ga0436365_0503098
247 Ga0451577_0191211
248 Ga0453683_0095539
249 Ga0453684_0002459
250 Ga0453684_0012504
251 Ga0453684_0134345
252 Ga0453684_0351492
253 Ga0451576_0615914
254 Ga0495668_0098619
255 Ga0495668_0148236
256 Ga0495636_0098935
257 Ga0496112_0230485
258 Ga0501038_0065687
259 Ga0501070_0067442
260 Ga0501073_0008004
261 Ga0501080_0058429
262 Ga0501083_0095460
263 nmdc:mga0n895_249738_c1
264 nmdc:mga08x19_43525_c1
265 nmdc:mga0a205_131725_c1
266 2548848698

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

5

214

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9413 1 198
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9345 4 201
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9287 3 200
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9208 4 201
7ac8-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9147 3 200
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9721 4 201 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9624 4 201 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9433 1 201 3.40.50.880
af_A0A1D6H537_1_181_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9319 55 201 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9309 4 203 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V8NKX7-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9918 4 199 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A2V8Q433-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9852 1 200 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A101G9J7-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9852 2 200 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A0J1FPK0-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9842 4 200 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A7V0V1W5-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9835 2 179 GO:0000105
GO:0000107
GO:0016787
GO:0016829

Map