F155225

General Info

Members Datasets Scaffolds Average Seq Length
133 86 266 273

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100004113|Ga0070689_1000041135
Length 314
Sequence MPVNPKSQIVNEVNQRKPNVAKGFQTALGCLPPTPNCAGSMTDYKVKFEVFEGPLDLLLYLIKKEEVDIYEVNLTQLATQFIEYIDVMRLLDLDIAGEFLVMASTLMYIKSRELLPVDQQVTPEGEEEGEDPRWELIRQLVEYKKFKDAAVQLQQLETRQENVFPRLPGKPQFADDEAPQRGHASLFDLLNAVNAILKRVNQREDLRDIFEDKWTVSEKIESIRHQITRTGRIRFSSLFAEATSRTEVVVTFLAMLELIRLRIVQALQDSPFAEIELWAAPPPADLPNTGEQFAAAAVADANASSPTDPSSPST

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 13.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100004113 3300005340 Bacteria 9800
2 Ga0065707_10233791 3300005295 Unclassified 1179
3 Ga0070690_100044793 3300005330 Unclassified 2809
4 Ga0070690_100065352 3300005330 Unclassified 2352
5 Ga0068868_100122269 3300005338 Bacteria 2124
6 Ga0070689_100258609 3300005340 Unclassified 1438
7 Ga0070689_100461155 3300005340 Bacteria 1083
8 Ga0070701_10009321 3300005438 Bacteria 4295
9 Ga0070705_100187811 3300005440 Bacteria 1406
10 Ga0070700_100205661 3300005441 Bacteria 1386
11 Ga0070694_100008705 3300005444 Bacteria 6215
12 Ga0070685_10029711 3300005466 Bacteria 3039
13 Ga0070686_100002034 3300005544 Bacteria 11213
14 Ga0070704_100016852 3300005549 Bacteria 4630
15 Ga0068857_100010056 3300005577 Bacteria 8218
16 Ga0068857_100150097 3300005577 Bacteria 2111
17 Ga0070702_100234298 3300005615 Bacteria 1235
18 Ga0068859_100532912 3300005617 Bacteria 1269
19 Ga0068864_100103636 3300005618 Bacteria 2526
20 Ga0068864_100243198 3300005618 Bacteria 1668
21 Ga0068863_100042167 3300005841 Bacteria 4336
22 Ga0068863_100062186 3300005841 Bacteria 3531
23 Ga0068863_100402041 3300005841 Bacteria 1340
24 Ga0081539_10138476 3300005985 Unclassified 1185
25 Ga0070712_100197051 3300006175 Bacteria 1580
26 Ga0068871_100234623 3300006358 Bacteria 1593
27 Ga0075428_100243076 3300006844 Bacteria 1942
28 Ga0097620_100532876 3300006931 Bacteria 1269
29 Ga0075435_100291220 3300007076 Unclassified 1395
30 Ga0105240_10014359 3300009093 Bacteria 10814
31 Ga0111539_10145338 3300009094 Bacteria 2777
32 Ga0111539_10151767 3300009094 Bacteria 2712
33 Ga0111539_10315154 3300009094 Bacteria 1820
34 Ga0105245_10361825 3300009098 Bacteria 1440
35 Ga0114129_10904882 3300009147 Bacteria 1118
36 Ga0114129_11069701 3300009147 Unclassified 1012
37 Ga0105242_10267594 3300009176 Bacteria 1547
38 Ga0105248_10518711 3300009177 Unclassified 1344
39 Ga0157374_10118164 3300013296 Bacteria 2557
40 Ga0157374_10391153 3300013296 Bacteria 1386
41 Ga0163162_10510384 3300013306 Bacteria 1332
42 Ga0157375_10110127 3300013308 Bacteria 2851
43 Ga0163163_10212734 3300014325 Bacteria 1982
44 Ga0157376_10324763 3300014969 Bacteria 1464
45 Ga0207662_10056036 3300025918 Unclassified 2353
46 Ga0207670_10041644 3300025936 Bacteria 3022
47 Ga0207711_10398756 3300025941 Unclassified 1278
48 Ga0207677_10136155 3300026023 Bacteria 1873
49 Ga0207708_10226457 3300026075 Bacteria 1500
50 Ga0207708_10276376 3300026075 Bacteria 1360
51 Ga0207641_10086301 3300026088 Bacteria 2736
52 Ga0207648_10416990 3300026089 Bacteria 1219
53 Ga0207674_10019033 3300026116 Bacteria 7441
54 Ga0207674_10455977 3300026116 Bacteria 1236
55 Ga0265337_1000127 3300028556 Bacteria 38567
56 Ga0265337_1000774 3300028556 Bacteria 16879
57 Ga0265337_1014463 3300028556 Bacteria 2616
58 Ga0265319_1000019 3300028563 Bacteria 154537
59 Ga0265334_10062095 3300028573 Unclassified 1407
60 Ga0265323_10000081 3300028653 Bacteria 54264
61 Ga0265336_10001761 3300028666 Bacteria 9495
62 Ga0265338_10001063 3300028800 Bacteria 45630
63 Ga0265338_10001689 3300028800 Bacteria 35059
64 Ga0265338_10001712 3300028800 Bacteria 34790
65 Ga0265338_10003117 3300028800 Bacteria 23719
66 Ga0265338_10004556 3300028800 Bacteria 18654
67 Ga0265338_10008143 3300028800 Bacteria 12789
68 Ga0265338_10024677 3300028800 Bacteria 6134
69 Ga0265338_10032849 3300028800 Bacteria 5051
70 Ga0265338_10160037 3300028800 Bacteria 1740
71 Ga0265324_10004415 3300029957 Bacteria 6369
72 Ga0265320_10008977 3300031240 Bacteria 6065
73 Ga0265320_10009794 3300031240 Bacteria 5747
74 Ga0265320_10013926 3300031240 Unclassified 4608
75 Ga0265320_10054379 3300031240 Bacteria 1931
76 Ga0265320_10055318 3300031240 Bacteria 1910
77 Ga0265320_10065508 3300031240 Bacteria 1724
78 Ga0265340_10060092 3300031247 Bacteria 1821
79 Ga0265339_10002641 3300031249 Bacteria 12778
80 Ga0265316_10006469 3300031344 Bacteria 11184
81 Ga0265316_10013367 3300031344 Bacteria 7296
82 Ga0265316_10033381 3300031344 Bacteria 4191
83 Ga0265314_10056374 3300031711 Bacteria 2705
84 Ga0265342_10018145 3300031712 Bacteria 4564
85 Ga0373926_0154497 3300035083 Unclassified 874
86 Ga0373954_0007484 3300035118 Unclassified 4777
87 Ga0373956_0123892 3300035119 Bacteria 1208
88 Ga0373955_0050935 3300035172 Bacteria 2254
89 Ga0373931_0201886 3300035691 Bacteria 1188
90 Ga0373933_0036197 3300035724 Bacteria 2888
91 Ga0373933_0200993 3300035724 Bacteria 1275
92 Ga0373947_0016264 3300035725 Bacteria 4276
93 Ga0373937_0089864 3300036401 Bacteria 2844
94 Ga0316582_0142169 3300036647 Bacteria 1618
95 Ga0316584_0106149 3300036712 Bacteria 2102
96 Ga0373925_0075174 3300037068 Bacteria 2560
97 Ga0451577_0024599 3300042876 Bacteria 5476
98 Ga0453684_0001817 3300044712 Bacteria 56194
99 Ga0453684_0388694 3300044712 Bacteria 1565
100 Ga0451576_0107767 3300045051 Bacteria 2899
101 Ga0451576_0160374 3300045051 Bacteria 2347
102 Ga0451576_0241582 3300045051 Bacteria 1887
103 Ga0451576_0269473 3300045051 Unclassified 1780
104 Ga0451576_0314301 3300045051 Bacteria 1639
105 Ga0451576_0504246 3300045051 Bacteria 1271
106 Ga0495641_0032913 3300046461 Unclassified 2464
107 Ga0495618_0038866 3300046514 Bacteria 2991
108 Ga0495630_0118928 3300046517 Unclassified 2004
109 Ga0495630_0391614 3300046517 Bacteria 1064
110 Ga0495640_0082351 3300046533 Bacteria 2137
111 Ga0495586_0001244 3300046535 Bacteria 14299
112 Ga0495586_0003663 3300046535 Bacteria 8237
113 Ga0495586_0181905 3300046535 Bacteria 1189
114 Ga0495645_0111314 3300046543 Bacteria 1937
115 Ga0495645_0141288 3300046543 Bacteria 1679
116 Ga0495667_0031413 3300046559 Bacteria 3566
117 Ga0495588_0086762 3300046674 Bacteria 1637
118 Ga0495658_0001657 3300046683 Bacteria 11584
119 Ga0495658_0017905 3300046683 Bacteria 3672
120 Ga0495658_0325843 3300046683 Bacteria 974
121 Ga0495613_0002510 3300046689 Bacteria 13831
122 Ga0495613_0012052 3300046689 Bacteria 6425
123 Ga0495613_0217319 3300046689 Bacteria 1343
124 Ga0495600_0279067 3300046809 Bacteria 1058
125 Ga0495674_0073668 3300047319 Bacteria 2943
126 Ga0495676_0101230 3300047321 Unclassified 2132
127 Ga0495680_0004359 3300047322 Bacteria 13556
128 Ga0495675_0058072 3300047444 Bacteria 2454
129 Ga0495675_0076489 3300047444 Bacteria 2110
130 Ga0495684_0257442 3300047471 Bacteria 1267
131 Ga0501034_0214791 3300049571 Bacteria 1878
132 nmdc:mga08y16_261393_c1 3300050511 Bacteria 1787
133 nmdc:mga08y16_375217_c1 3300050511 Bacteria 1458
134 Ga0070689_100004113
135 Ga0065707_10233791
136 Ga0070690_100044793
137 Ga0070690_100065352
138 Ga0068868_100122269
139 Ga0070689_100258609
140 Ga0070689_100461155
141 Ga0070701_10009321
142 Ga0070705_100187811
143 Ga0070700_100205661
144 Ga0070694_100008705
145 Ga0070685_10029711
146 Ga0070686_100002034
147 Ga0070704_100016852
148 Ga0068857_100010056
149 Ga0068857_100150097
150 Ga0070702_100234298
151 Ga0068859_100532912
152 Ga0068864_100103636
153 Ga0068864_100243198
154 Ga0068863_100042167
155 Ga0068863_100062186
156 Ga0068863_100402041
157 Ga0081539_10138476
158 Ga0070712_100197051
159 Ga0068871_100234623
160 Ga0075428_100243076
161 Ga0097620_100532876
162 Ga0075435_100291220
163 Ga0105240_10014359
164 Ga0111539_10145338
165 Ga0111539_10151767
166 Ga0111539_10315154
167 Ga0105245_10361825
168 Ga0114129_10904882
169 Ga0114129_11069701
170 Ga0105242_10267594
171 Ga0105248_10518711
172 Ga0157374_10118164
173 Ga0157374_10391153
174 Ga0163162_10510384
175 Ga0157375_10110127
176 Ga0163163_10212734
177 Ga0157376_10324763
178 Ga0207662_10056036
179 Ga0207670_10041644
180 Ga0207711_10398756
181 Ga0207677_10136155
182 Ga0207708_10226457
183 Ga0207708_10276376
184 Ga0207641_10086301
185 Ga0207648_10416990
186 Ga0207674_10019033
187 Ga0207674_10455977
188 Ga0265337_1000127
189 Ga0265337_1000774
190 Ga0265337_1014463
191 Ga0265319_1000019
192 Ga0265334_10062095
193 Ga0265323_10000081
194 Ga0265336_10001761
195 Ga0265338_10001063
196 Ga0265338_10001689
197 Ga0265338_10001712
198 Ga0265338_10003117
199 Ga0265338_10004556
200 Ga0265338_10008143
201 Ga0265338_10024677
202 Ga0265338_10032849
203 Ga0265338_10160037
204 Ga0265324_10004415
205 Ga0265320_10008977
206 Ga0265320_10009794
207 Ga0265320_10013926
208 Ga0265320_10054379
209 Ga0265320_10055318
210 Ga0265320_10065508
211 Ga0265340_10060092
212 Ga0265339_10002641
213 Ga0265316_10006469
214 Ga0265316_10013367
215 Ga0265316_10033381
216 Ga0265314_10056374
217 Ga0265342_10018145
218 Ga0373926_0154497
219 Ga0373954_0007484
220 Ga0373956_0123892
221 Ga0373955_0050935
222 Ga0373931_0201886
223 Ga0373933_0036197
224 Ga0373933_0200993
225 Ga0373947_0016264
226 Ga0373937_0089864
227 Ga0316582_0142169
228 Ga0316584_0106149
229 Ga0373925_0075174
230 Ga0451577_0024599
231 Ga0453684_0001817
232 Ga0453684_0388694
233 Ga0451576_0107767
234 Ga0451576_0160374
235 Ga0451576_0241582
236 Ga0451576_0269473
237 Ga0451576_0314301
238 Ga0451576_0504246
239 Ga0495641_0032913
240 Ga0495618_0038866
241 Ga0495630_0118928
242 Ga0495630_0391614
243 Ga0495640_0082351
244 Ga0495586_0001244
245 Ga0495586_0003663
246 Ga0495586_0181905
247 Ga0495645_0111314
248 Ga0495645_0141288
249 Ga0495667_0031413
250 Ga0495588_0086762
251 Ga0495658_0001657
252 Ga0495658_0017905
253 Ga0495658_0325843
254 Ga0495613_0002510
255 Ga0495613_0012052
256 Ga0495613_0217319
257 Ga0495600_0279067
258 Ga0495674_0073668
259 Ga0495676_0101230
260 Ga0495680_0004359
261 Ga0495675_0058072
262 Ga0495675_0076489
263 Ga0495684_0257442
264 Ga0501034_0214791
265 nmdc:mga08y16_261393_c1
266 nmdc:mga08y16_375217_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02616

SMC_ScpA

Segregation and condensation protein ScpA

61

279

0.92

Map