F153729

General Info

Members Datasets Scaffolds Average Seq Length
132 105 264 133

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0884317|Ga0453684_0884317_185_643
Length 152
Sequence MVLLRKNMLVSPKHAEVGVMQTAELNVSTVRRTQFVPISAQLAELVVRSRWQDGILTVFVPHTTAGITINENADPDVARDMEQFCDQFIPPSSRFRHAEGNSDSHLKASFFGSSLQIIVRNGSMWLGTWQGVYFCEFDGPRRRTVQVAFTGE

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
67 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 5.3
Rhizosphere 85.61
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0884317 3300044712 Bacteria 958
2 Ga0070680_100285880 3300005336 Bacteria 1398
3 Ga0068868_100163359 3300005338 Bacteria 1840
4 Ga0070660_100288858 3300005339 Bacteria 1343
5 Ga0070691_10035435 3300005341 Bacteria 2350
6 Ga0070661_100309264 3300005344 Bacteria 1232
7 Ga0070668_100133154 3300005347 Bacteria 1997
8 Ga0070674_100080235 3300005356 Bacteria 2329
9 Ga0070659_100159210 3300005366 Bacteria 1845
10 Ga0070711_100564030 3300005439 Unclassified 946
11 Ga0070705_100319054 3300005440 Bacteria 1121
12 Ga0070700_100026157 3300005441 Bacteria 3443
13 Ga0070694_100046106 3300005444 Bacteria 2924
14 Ga0070662_100190540 3300005457 Bacteria 1621
15 Ga0070707_100013198 3300005468 Bacteria 7722
16 Ga0070686_100380133 3300005544 Bacteria 1069
17 Ga0070696_100109858 3300005546 Bacteria 1985
18 Ga0068854_100030429 3300005578 Bacteria 3744
19 Ga0068866_10340460 3300005718 Bacteria 950
20 Ga0068861_100235827 3300005719 Bacteria 1554
21 Ga0068851_10383529 3300005834 Bacteria 824
22 Ga0081455_10018713 3300005937 Bacteria 6576
23 Ga0081540_1000836 3300005983 Bacteria 28072
24 Ga0075364_10042562 3300006051 Bacteria 2951
25 Ga0070716_100707043 3300006173 Unclassified 771
26 Ga0070712_100898987 3300006175 Bacteria 763
27 Ga0097621_100397511 3300006237 Unclassified 1233
28 Ga0068871_100191920 3300006358 Bacteria 1760
29 Ga0075431_100721862 3300006847 Bacteria 973
30 Ga0075433_10424144 3300006852 Bacteria 1173
31 Ga0075434_101670488 3300006871 Bacteria 645
32 Ga0068865_100131074 3300006881 Bacteria 1879
33 Ga0075436_100592893 3300006914 Bacteria 816
34 Ga0105245_10002728 3300009098 Bacteria 15889
35 Ga0105243_10021459 3300009148 Bacteria 4903
36 Ga0105238_11081666 3300009551 Bacteria 824
37 Ga0105239_10577572 3300010375 Bacteria 1281
38 Ga0157373_10260936 3300013100 Bacteria 1226
39 Ga0157378_12543766 3300013297 Bacteria 564
40 Ga0157380_10054232 3300014326 Bacteria 3181
41 Ga0213876_10062285 3300021384 Bacteria 1969
42 Ga0213876_10154723 3300021384 Bacteria 1219
43 Ga0213876_10168758 3300021384 Bacteria 1164
44 Ga0207656_10431475 3300025321 Bacteria 665
45 Ga0207688_10036770 3300025901 Bacteria 2714
46 Ga0207707_10467094 3300025912 Bacteria 1079
47 Ga0207693_10022133 3300025915 Bacteria 5054
48 Ga0207693_10852886 3300025915 Unclassified 700
49 Ga0207660_10185828 3300025917 Bacteria 1616
50 Ga0207662_10321579 3300025918 Bacteria 1033
51 Ga0207657_10444514 3300025919 Bacteria 1017
52 Ga0207652_10498834 3300025921 Bacteria 1096
53 Ga0207687_10024027 3300025927 Bacteria 4067
54 Ga0207690_10526340 3300025932 Bacteria 959
55 Ga0207706_10037573 3300025933 Bacteria 4298
56 Ga0207669_10039059 3300025937 Bacteria 2739
57 Ga0207712_10868372 3300025961 Bacteria 796
58 Ga0207668_10084596 3300025972 Bacteria 2312
59 Ga0207678_11992248 3300026067 Bacteria 505
60 Ga0207708_10003157 3300026075 Bacteria 12136
61 Ga0207648_10027861 3300026089 Bacteria 5012
62 Ga0207675_100096070 3300026118 Bacteria 2789
63 Ga0265770_1013532 3300030878 Bacteria 1222
64 Ga0265760_10000426 3300031090 Bacteria 11846
65 Ga0265327_10190406 3300031251 Bacteria 934
66 Ga0316576_10089634 3300031727 Bacteria 2291
67 Ga0316576_10683422 3300031727 Bacteria 745
68 Ga0316578_10477021 3300031728 Bacteria 736
69 Ga0316577_10036347 3300031733 Bacteria 2755
70 Ga0316577_10390246 3300031733 Bacteria 791
71 Ga0316212_1023679 3300033547 Unclassified 860
72 Ga0373928_0000202 3300035084 Bacteria 11499
73 Ga0373928_0277614 3300035084 Unclassified 507
74 Ga0373932_0010707 3300035112 Bacteria 2226
75 Ga0316574_0325234 3300035398 Bacteria 976
76 Ga0373924_0365082 3300035410 Bacteria 644
77 Ga0316582_0080847 3300036647 Bacteria 2122
78 Ga0316582_0171335 3300036647 Bacteria 1474
79 Ga0316584_1079974 3300036712 Bacteria 533
80 Ga0395900_0014747 3300037418 Bacteria 7965
81 Ga0395898_0004081 3300037466 Bacteria 16016
82 Ga0395905_0007337 3300037471 Bacteria 10983
83 Ga0395905_1158876 3300037471 Bacteria 676
84 Ga0436364_0460432 3300037853 Bacteria 1129
85 Ga0436364_1236162 3300037853 Unclassified 536
86 Ga0395901_0003066 3300038443 Bacteria 16843
87 Ga0436365_0557982 3300039437 Unclassified 3056
88 Ga0436365_0655441 3300039437 Unclassified 512
89 Ga0436365_1260806 3300039437 Bacteria 1649
90 Ga0436360_1182166 3300039438 Unclassified 600
91 Ga0436363_1589390 3300039450 Bacteria 663
92 Ga0436362_1010641 3300039453 Bacteria 858
93 Ga0436362_1162319 3300039453 Bacteria 1861
94 Ga0451802_1626257 3300041460 Bacteria 522
95 Ga0451853_0019859 3300041512 Bacteria 663
96 Ga0451577_0213150 3300042876 Bacteria 1745
97 Ga0451577_0610535 3300042876 Bacteria 990
98 Ga0453683_0000002 3300044673 Bacteria 1244396
99 Ga0453683_0001546 3300044673 Bacteria 19514
100 Ga0453683_0045304 3300044673 Unclassified 2758
101 Ga0453683_0133887 3300044673 Bacteria 1563
102 Ga0453683_0137193 3300044673 Bacteria 1543
103 Ga0453683_0230175 3300044673 Unclassified 1180
104 Ga0466964_0742028 3300044706 Bacteria 550
105 Ga0453684_0029591 3300044712 Bacteria 7769
106 Ga0453684_0039040 3300044712 Bacteria 6476
107 Ga0453684_1091797 3300044712 Bacteria 843
108 Ga0466959_0395566 3300045049 Bacteria 940
109 Ga0451576_0000382 3300045051 Bacteria 103605
110 Ga0451576_0011513 3300045051 Bacteria 10042
111 Ga0451576_0229780 3300045051 Bacteria 1937
112 Ga0451576_0469497 3300045051 Bacteria 1321
113 Ga0451576_0568757 3300045051 Bacteria 1191
114 Ga0451576_0872534 3300045051 Bacteria 944
115 Ga0466967_1164568 3300045976 Unclassified 768
116 Ga0495586_0023035 3300046535 Bacteria 3325
117 Ga0495636_0245560 3300047318 Bacteria 827
118 Ga0495626_0193669 3300048091 Bacteria 837
119 Ga0496101_0406741 3300048904 Bacteria 1072
120 Ga0496102_0095111 3300048905 Bacteria 2761
121 Ga0496103_0452476 3300048906 Bacteria 823
122 Ga0496109_0034657 3300048912 Bacteria 4549
123 Ga0496110_0176114 3300048913 Bacteria 1941
124 Ga0496111_0033104 3300048914 Bacteria 3686
125 Ga0501040_0056919 3300049576 Bacteria 2684
126 Ga0501040_1089291 3300049576 Bacteria 579
127 nmdc:mga05p37_636541_c1 3300050507 Bacteria 1197
128 nmdc:mga09592_67203_c1 3300050508 Bacteria 3039
129 nmdc:mga06r32_618305_c1 3300050510 Bacteria 1053
130 nmdc:mga0n895_198721_c1 3300050512 Bacteria 2036
131 nmdc:mga0rr50_577968_c1 3300050513 Bacteria 957
132 Ga0501082_0348431 3300060353 Bacteria 1291
133 Ga0453684_0884317
134 Ga0070680_100285880
135 Ga0068868_100163359
136 Ga0070660_100288858
137 Ga0070691_10035435
138 Ga0070661_100309264
139 Ga0070668_100133154
140 Ga0070674_100080235
141 Ga0070659_100159210
142 Ga0070711_100564030
143 Ga0070705_100319054
144 Ga0070700_100026157
145 Ga0070694_100046106
146 Ga0070662_100190540
147 Ga0070707_100013198
148 Ga0070686_100380133
149 Ga0070696_100109858
150 Ga0068854_100030429
151 Ga0068866_10340460
152 Ga0068861_100235827
153 Ga0068851_10383529
154 Ga0081455_10018713
155 Ga0081540_1000836
156 Ga0075364_10042562
157 Ga0070716_100707043
158 Ga0070712_100898987
159 Ga0097621_100397511
160 Ga0068871_100191920
161 Ga0075431_100721862
162 Ga0075433_10424144
163 Ga0075434_101670488
164 Ga0068865_100131074
165 Ga0075436_100592893
166 Ga0105245_10002728
167 Ga0105243_10021459
168 Ga0105238_11081666
169 Ga0105239_10577572
170 Ga0157373_10260936
171 Ga0157378_12543766
172 Ga0157380_10054232
173 Ga0213876_10062285
174 Ga0213876_10154723
175 Ga0213876_10168758
176 Ga0207656_10431475
177 Ga0207688_10036770
178 Ga0207707_10467094
179 Ga0207693_10022133
180 Ga0207693_10852886
181 Ga0207660_10185828
182 Ga0207662_10321579
183 Ga0207657_10444514
184 Ga0207652_10498834
185 Ga0207687_10024027
186 Ga0207690_10526340
187 Ga0207706_10037573
188 Ga0207669_10039059
189 Ga0207712_10868372
190 Ga0207668_10084596
191 Ga0207678_11992248
192 Ga0207708_10003157
193 Ga0207648_10027861
194 Ga0207675_100096070
195 Ga0265770_1013532
196 Ga0265760_10000426
197 Ga0265327_10190406
198 Ga0316576_10089634
199 Ga0316576_10683422
200 Ga0316578_10477021
201 Ga0316577_10036347
202 Ga0316577_10390246
203 Ga0316212_1023679
204 Ga0373928_0000202
205 Ga0373928_0277614
206 Ga0373932_0010707
207 Ga0316574_0325234
208 Ga0373924_0365082
209 Ga0316582_0080847
210 Ga0316582_0171335
211 Ga0316584_1079974
212 Ga0395900_0014747
213 Ga0395898_0004081
214 Ga0395905_0007337
215 Ga0395905_1158876
216 Ga0436364_0460432
217 Ga0436364_1236162
218 Ga0395901_0003066
219 Ga0436365_0557982
220 Ga0436365_0655441
221 Ga0436365_1260806
222 Ga0436360_1182166
223 Ga0436363_1589390
224 Ga0436362_1010641
225 Ga0436362_1162319
226 Ga0451802_1626257
227 Ga0451853_0019859
228 Ga0451577_0213150
229 Ga0451577_0610535
230 Ga0453683_0000002
231 Ga0453683_0001546
232 Ga0453683_0045304
233 Ga0453683_0133887
234 Ga0453683_0137193
235 Ga0453683_0230175
236 Ga0466964_0742028
237 Ga0453684_0029591
238 Ga0453684_0039040
239 Ga0453684_1091797
240 Ga0466959_0395566
241 Ga0451576_0000382
242 Ga0451576_0011513
243 Ga0451576_0229780
244 Ga0451576_0469497
245 Ga0451576_0568757
246 Ga0451576_0872534
247 Ga0466967_1164568
248 Ga0495586_0023035
249 Ga0495636_0245560
250 Ga0495626_0193669
251 Ga0496101_0406741
252 Ga0496102_0095111
253 Ga0496103_0452476
254 Ga0496109_0034657
255 Ga0496110_0176114
256 Ga0496111_0033104
257 Ga0501040_0056919
258 Ga0501040_1089291
259 nmdc:mga05p37_636541_c1
260 nmdc:mga09592_67203_c1
261 nmdc:mga06r32_618305_c1
262 nmdc:mga0n895_198721_c1
263 nmdc:mga0rr50_577968_c1
264 Ga0501082_0348431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

37

149

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9555 2 132
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9472 1 131
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9433 2 128
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9402 1 131
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9356 2 128
ID Description Score Start End Superfamily
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9458 1 132 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9387 1 132 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9365 2 132 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9362 2 128 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9302 2 132 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A7V9G069-F1-model_v4 YjbQ family protein 0.9696 1 132
AF-A0A2V9HNZ7-F1-model_v4 YjbQ family protein 0.9646 1 131
AF-A0A660Q5K2-F1-model_v4 YjbQ family protein 0.9634 1 129
AF-A0A1L8D4I6-F1-model_v4 YjbQ family protein 0.962 1 131
AF-A0A536AUJ1-F1-model_v4 YjbQ family protein 0.9616 2 129

Map