F153554

General Info

Members Datasets Scaffolds Average Seq Length
132 70 264 166

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_17744|Ga0400487_17744_7268_7819
Length 183
Sequence MSALLSSGDSVTEAAPVRAWLSLGSNIDPKRQIPAALQTLRSSFGELVVSPIYESEAVGFSGDNFYNLVVGIWTRLSARALAGRLREIEAAHGRVRGAEKFSSRTLDIDLLTFGEQVIDEPGVQVPRDEILRYAFVLRPLADVAPEERHPVAGRSYAALWSAFDRGSQKLWRVDGHQDPPVKR

Samples

Sample ID Description Type Environment
1 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
11 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
12 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
23 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
24 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
25 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
26 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
27 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
28 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
29 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
30 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
31 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
32 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
35 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
36 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
39 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
40 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
41 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
42 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
43 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
44 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
45 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
50 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
51 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
52 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
61 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
62 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
66 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
67 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
68 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
69 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
70 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 3.03
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 0.76
Rhizosphere 71.21
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400487_17744 3300039110 Bacteria 9324
2 Ga0070658_10418814 3300005327 Bacteria 1152
3 Ga0070670_100187268 3300005331 Bacteria 1797
4 Ga0068869_100199181 3300005334 Bacteria 1578
5 Ga0070682_100339528 3300005337 Bacteria 1116
6 Ga0070714_100000857 3300005435 Bacteria 21561
7 Ga0070714_100006416 3300005435 Bacteria 9085
8 Ga0070713_100062268 3300005436 Bacteria 3125
9 Ga0068853_100418616 3300005539 Bacteria 1256
10 Ga0068857_100206991 3300005577 Bacteria 1789
11 Ga0105245_10162716 3300009098 Bacteria 2119
12 Ga0105241_10358897 3300009174 Bacteria 1268
13 Ga0105248_10323902 3300009177 Bacteria 1736
14 Ga0105239_10006301 3300010375 Bacteria 13797
15 Ga0157370_10079864 3300013104 Bacteria 3080
16 Ga0207654_10010246 3300025911 Bacteria 4770
17 Ga0207663_10251984 3300025916 Unclassified 1300
18 Ga0207649_10238366 3300025920 Bacteria 1305
19 Ga0207650_10153299 3300025925 Bacteria 1820
20 Ga0207687_10102928 3300025927 Bacteria 2105
21 Ga0207700_10085500 3300025928 Bacteria 2476
22 Ga0207664_10000873 3300025929 Bacteria 20374
23 Ga0207664_10010003 3300025929 Bacteria 6683
24 Ga0265327_10000881 3300031251 Bacteria 44377
25 Ga0265327_10002076 3300031251 Bacteria 22390
26 Ga0265327_10081709 3300031251 Bacteria 1595
27 Ga0265316_10001619 3300031344 Bacteria 24014
28 Ga0316575_10147871 3300031665 Bacteria 968
29 Ga0316579_10008634 3300031691 Bacteria 4255
30 Ga0316579_10079557 3300031691 Bacteria 1559
31 Ga0316579_10079712 3300031691 Unclassified 1558
32 Ga0316576_10037654 3300031727 Bacteria 3464
33 Ga0316576_10322769 3300031727 Bacteria 1151
34 Ga0316576_10367308 3300031727 Bacteria 1069
35 Ga0316578_10314192 3300031728 Bacteria 936
36 Ga0316577_10056999 3300031733 Bacteria 2181
37 Ga0316577_10063854 3300031733 Bacteria 2056
38 Ga0316577_10336650 3300031733 Bacteria 856
39 Ga0316583_10006988 3300032133 Bacteria 4062
40 Ga0316583_10016701 3300032133 Bacteria 2640
41 Ga0316585_10129193 3300032137 Bacteria 833
42 Ga0316580_10073882 3300032139 Bacteria 1044
43 Ga0316593_10001403 3300032168 Bacteria 5294
44 Ga0316593_10006776 3300032168 Bacteria 3114
45 Ga0316596_1002818 3300033541 Bacteria 3757
46 Ga0316596_1133934 3300033541 Unclassified 677
47 Ga0373961_0144575 3300035241 Bacteria 806
48 Ga0316574_0083529 3300035398 Bacteria 2030
49 Ga0316574_0239687 3300035398 Unclassified 1159
50 Ga0316574_0696640 3300035398 Bacteria 623
51 Ga0316582_0007249 3300036647 Bacteria 5896
52 Ga0316582_0019299 3300036647 Bacteria 3988
53 Ga0316582_0373456 3300036647 Bacteria 981
54 Ga0316582_0411678 3300036647 Bacteria 931
55 Ga0316582_0558937 3300036647 Unclassified 788
56 Ga0316584_0001911 3300036712 Bacteria 12958
57 Ga0316584_0127645 3300036712 Bacteria 1899
58 Ga0316584_0176064 3300036712 Bacteria 1585
59 Ga0316584_0176786 3300036712 Bacteria 1581
60 Ga0316584_0207372 3300036712 Bacteria 1444
61 Ga0316584_0214052 3300036712 Bacteria 1417
62 Ga0316584_0306978 3300036712 Bacteria 1148
63 Ga0316581_0006597 3300037588 Bacteria 3079
64 Ga0316581_0019181 3300037588 Bacteria 1992
65 Ga0400484_21110 3300038725 Bacteria 15042
66 Ga0400484_42346 3300038725 Bacteria 3697
67 Ga0400490_06574 3300038726 Bacteria 20954
68 Ga0400490_14203 3300038726 Unclassified 1095
69 Ga0400490_29375 3300038726 Bacteria 7433
70 Ga0400490_37862 3300038726 Unclassified 1246
71 Ga0400490_39253 3300038726 Bacteria 9947
72 Ga0400491_04788 3300038727 Bacteria 2165
73 Ga0400485_10051 3300038735 Bacteria 70678
74 Ga0400488_08911 3300038741 Bacteria 1119
75 Ga0400488_18991 3300038741 Bacteria 1016
76 Ga0400488_22295 3300038741 Unclassified 1028
77 Ga0400488_41818 3300038741 Bacteria 3025
78 Ga0400488_53270 3300038741 Bacteria 11614
79 Ga0400488_63472 3300038741 Bacteria 27269
80 Ga0400486_18851 3300038742 Bacteria 47783
81 Ga0400486_19627 3300038742 Bacteria 369894
82 Ga0400486_29154 3300038742 Bacteria 9262
83 Ga0400483_019053 3300039062 Unclassified 1163
84 Ga0400483_129369 3300039062 Bacteria 6413
85 Ga0400483_151300 3300039062 Bacteria 4290
86 Ga0400483_174495 3300039062 Bacteria 6365
87 Ga0400483_231687 3300039062 Unclassified 4566
88 Ga0400483_288087 3300039062 Bacteria 26272
89 Ga0400487_10529 3300039110 Bacteria 3170
90 Ga0400487_38243 3300039110 Bacteria 71080
91 Ga0400487_46216 3300039110 Bacteria 6977
92 Ga0400487_48614 3300039110 Bacteria 10054
93 Ga0400487_54277 3300039110 Bacteria 2780
94 Ga0400487_57700 3300039110 Bacteria 2005
95 Ga0400487_61225 3300039110 Bacteria 55886
96 Ga0466972_0003503 3300044658 Bacteria 7792
97 Ga0453684_0058825 3300044712 Bacteria 4961
98 Ga0453684_0075237 3300044712 Bacteria 4245
99 Ga0453684_0918112 3300044712 Unclassified 936
100 Ga0451576_0020376 3300045051 Bacteria 7223
101 Ga0496103_0422189 3300048906 Bacteria 856
102 Ga0496124_0022930 3300048927 Bacteria 5712
103 Ga0496126_0704493 3300048929 Bacteria 784
104 Ga0501031_0570179 3300049568 Bacteria 729
105 Ga0501033_0066383 3300049570 Bacteria 2653
106 Ga0501034_0001755 3300049571 Bacteria 27784
107 Ga0501034_0112808 3300049571 Bacteria 2708
108 Ga0501034_0430885 3300049571 Bacteria 1239
109 Ga0501042_0014962 3300049578 Bacteria 5304
110 Ga0501043_0056589 3300049579 Bacteria 3080
111 Ga0501046_0051180 3300049580 Bacteria 3260
112 Ga0501047_0002144 3300049581 Bacteria 18887
113 Ga0501048_0288138 3300049582 Unclassified 1168
114 Ga0501070_0017590 3300049586 Bacteria 6001
115 Ga0501070_0112803 3300049586 Bacteria 2247
116 Ga0501070_0137482 3300049586 Bacteria 2017
117 Ga0501073_0049310 3300049589 Bacteria 2953
118 Ga0501074_0034983 3300049590 Bacteria 3640
119 Ga0501074_0047266 3300049590 Bacteria 3111
120 Ga0501080_0030407 3300049742 Bacteria 5031
121 Ga0501080_0114566 3300049742 Bacteria 2499
122 Ga0501035_0017708 3300049822 Bacteria 6571
123 Ga0501035_0284470 3300049822 Bacteria 1397
124 Ga0501044_0000213 3300049823 Bacteria 73593
125 Ga0501044_0066193 3300049823 Bacteria 3685
126 Ga0501044_0517436 3300049823 Bacteria 1093
127 Ga0500651_0000317 3300053093 Bacteria 27616
128 Ga0500636_0239140 3300053177 Bacteria 934
129 Ga0500661_008353 3300055283 Bacteria 1904
130 Ga0501082_0220080 3300060353 Bacteria 1652
131 Ga0501082_1016123 3300060353 Bacteria 725
132 2916181049 2916178963 Bacteria 5265078
133 Ga0400487_17744
134 Ga0070658_10418814
135 Ga0070670_100187268
136 Ga0068869_100199181
137 Ga0070682_100339528
138 Ga0070714_100000857
139 Ga0070714_100006416
140 Ga0070713_100062268
141 Ga0068853_100418616
142 Ga0068857_100206991
143 Ga0105245_10162716
144 Ga0105241_10358897
145 Ga0105248_10323902
146 Ga0105239_10006301
147 Ga0157370_10079864
148 Ga0207654_10010246
149 Ga0207663_10251984
150 Ga0207649_10238366
151 Ga0207650_10153299
152 Ga0207687_10102928
153 Ga0207700_10085500
154 Ga0207664_10000873
155 Ga0207664_10010003
156 Ga0265327_10000881
157 Ga0265327_10002076
158 Ga0265327_10081709
159 Ga0265316_10001619
160 Ga0316575_10147871
161 Ga0316579_10008634
162 Ga0316579_10079557
163 Ga0316579_10079712
164 Ga0316576_10037654
165 Ga0316576_10322769
166 Ga0316576_10367308
167 Ga0316578_10314192
168 Ga0316577_10056999
169 Ga0316577_10063854
170 Ga0316577_10336650
171 Ga0316583_10006988
172 Ga0316583_10016701
173 Ga0316585_10129193
174 Ga0316580_10073882
175 Ga0316593_10001403
176 Ga0316593_10006776
177 Ga0316596_1002818
178 Ga0316596_1133934
179 Ga0373961_0144575
180 Ga0316574_0083529
181 Ga0316574_0239687
182 Ga0316574_0696640
183 Ga0316582_0007249
184 Ga0316582_0019299
185 Ga0316582_0373456
186 Ga0316582_0411678
187 Ga0316582_0558937
188 Ga0316584_0001911
189 Ga0316584_0127645
190 Ga0316584_0176064
191 Ga0316584_0176786
192 Ga0316584_0207372
193 Ga0316584_0214052
194 Ga0316584_0306978
195 Ga0316581_0006597
196 Ga0316581_0019181
197 Ga0400484_21110
198 Ga0400484_42346
199 Ga0400490_06574
200 Ga0400490_14203
201 Ga0400490_29375
202 Ga0400490_37862
203 Ga0400490_39253
204 Ga0400491_04788
205 Ga0400485_10051
206 Ga0400488_08911
207 Ga0400488_18991
208 Ga0400488_22295
209 Ga0400488_41818
210 Ga0400488_53270
211 Ga0400488_63472
212 Ga0400486_18851
213 Ga0400486_19627
214 Ga0400486_29154
215 Ga0400483_019053
216 Ga0400483_129369
217 Ga0400483_151300
218 Ga0400483_174495
219 Ga0400483_231687
220 Ga0400483_288087
221 Ga0400487_10529
222 Ga0400487_38243
223 Ga0400487_46216
224 Ga0400487_48614
225 Ga0400487_54277
226 Ga0400487_57700
227 Ga0400487_61225
228 Ga0466972_0003503
229 Ga0453684_0058825
230 Ga0453684_0075237
231 Ga0453684_0918112
232 Ga0451576_0020376
233 Ga0496103_0422189
234 Ga0496124_0022930
235 Ga0496126_0704493
236 Ga0501031_0570179
237 Ga0501033_0066383
238 Ga0501034_0001755
239 Ga0501034_0112808
240 Ga0501034_0430885
241 Ga0501042_0014962
242 Ga0501043_0056589
243 Ga0501046_0051180
244 Ga0501047_0002144
245 Ga0501048_0288138
246 Ga0501070_0017590
247 Ga0501070_0112803
248 Ga0501070_0137482
249 Ga0501073_0049310
250 Ga0501074_0034983
251 Ga0501074_0047266
252 Ga0501080_0030407
253 Ga0501080_0114566
254 Ga0501035_0017708
255 Ga0501035_0284470
256 Ga0501044_0000213
257 Ga0501044_0066193
258 Ga0501044_0517436
259 Ga0500651_0000317
260 Ga0500636_0239140
261 Ga0500661_008353
262 Ga0501082_0220080
263 Ga0501082_1016123
264 2916181049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

20

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cg8-assembly1.cif.gz_D-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.924 2 146
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9127 2 146
2cg8-assembly1.cif.gz_B-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.903 2 146
3ilo-assembly1.cif.gz_A crystal structure of e. coli hppk(d97a) in complex with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin 0.8967 3 158
3kuh-assembly1.cif.gz_A crystal structure of e. coli hppk(h115a) in complex with ampcpp and hp 0.8961 3 158
ID Description Score Start End Superfamily
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9193 2 144 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8976 1 161 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8923 1 161 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8718 2 144 3.30.70.560
af_P9WNC7_1_182_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8669 1 152 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A522RN57-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9884 1 99 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-I4W349-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9833 1 158 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A5B2Z8Z1-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9823 1 159 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A2A4RCV3-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9806 1 98 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A2T2UBD5-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase) 0.9805 1 103 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Map