F153034

General Info

Members Datasets Scaffolds Average Seq Length
132 113 109 187

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10000003|Ga0207709_10000003857
Length 216
Sequence MFFIGRCRVGCFSLRPFFYSFVLYLKEMSKRKIVVAITGASGSIYAKLLLEKLNSLKSQLAEVGIVMSNNAKDVWRAELGDESYQDVPFKFYDKSDFFAPFASGSARFDTMIVCPCSMGTLSRIAYGTSSDLTTRAADVMLKERRKLILVTRETPLSIIHIQNMKLVTEAGGIICPASPSFYSLPKTLEELAETVVDRILSLAGFDFKHYQWGENS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
9 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
12 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
13 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
14 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
15 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
16 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
17 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
18 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
19 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
20 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
21 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
98 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
101 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
102 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
103 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
104 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
105 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
108 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
112 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
113 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.58
Metatranscriptomes 0
Isolates 17.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.48
Nodule 0
Rhizoplane 1.52
Rhizosphere 59.09
Stem 0
Stem Tuber 0
Unclassified 15.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3347165 2162886007 Bacteria 1252
2 JGI25152J39213_1000136 3300002773 Bacteria 50151
3 JGI25150J39212_1000008 3300002774 Bacteria 253098
4 JGI25151J46595_10000014 3300003187 Bacteria 253098
5 JGI25153J46596_10000020 3300003215 Bacteria 252978
6 rootH2_10108297 3300003320 Bacteria 5159
7 rootH2_10114990 3300003320 Bacteria 10431
8 rootL2_10196287 3300003322 Bacteria 4980
9 rootL2_10197502 3300003322 Bacteria 1133
10 rootH1_10013268 3300003323 Bacteria 8137
11 rootH1_10054302 3300003323 Bacteria 10283
12 rootH1_10144560 3300003323 Bacteria 9830
13 JGI25160J50197_1016254 3300003354 Bacteria 2404
14 Ga0055535_1002399 3300003761 Bacteria 6661
15 Ga0055542_1005182 3300003762 Bacteria 2994
16 Ga0065714_10230805 3300005288 Bacteria 801
17 Ga0065704_10003755 3300005289 Bacteria 4890
18 Ga0068869_100215047 3300005334 Bacteria 1521
19 Ga0068868_100119660 3300005338 Bacteria 2147
20 Ga0070660_100040378 3300005339 Bacteria 3551
21 Ga0070669_100492919 3300005353 Bacteria 1015
22 Ga0070659_100053839 3300005366 Bacteria 3168
23 Ga0070713_100375645 3300005436 Bacteria 1323
24 Ga0070681_10405502 3300005458 Bacteria 1275
25 Ga0068853_100000017 3300005539 Bacteria 170544
26 Ga0068853_100571896 3300005539 Bacteria 1072
27 Ga0068859_101155109 3300005617 Bacteria 852
28 Ga0068863_101225806 3300005841 Bacteria 756
29 Ga0097620_101155112 3300006931 Bacteria 852
30 Ga0105243_10000025 3300009148 Bacteria 193732
31 Ga0105242_10233150 3300009176 Bacteria 1651
32 Ga0105239_10274376 3300010375 Bacteria 1897
33 Ga0157373_10008857 3300013100 Bacteria 7449
34 Ga0157373_10034906 3300013100 Bacteria 3612
35 Ga0157371_10006946 3300013102 Bacteria 9226
36 Ga0157371_10090263 3300013102 Bacteria 2171
37 Ga0157370_10135446 3300013104 Bacteria 2296
38 Ga0163162_10685288 3300013306 Bacteria 1147
39 Ga0157372_10002418 3300013307 Bacteria 20212
40 Ga0157372_10237856 3300013307 Bacteria 2113
41 Ga0157372_10549002 3300013307 Bacteria 1347
42 Ga0157372_10868219 3300013307 Bacteria 1047
43 Ga0157372_11147795 3300013307 Bacteria 898
44 Ga0157380_10000173 3300014326 Bacteria 37297
45 Ga0157376_10195398 3300014969 Bacteria 1858
46 Ga0209436_103695 3300025208 Bacteria 3982
47 Ga0209258_100145 3300025242 Bacteria 163672
48 Ga0207425_1000007 3300025245 Bacteria 777411
49 Ga0209148_1000177 3300025254 Bacteria 127365
50 Ga0209129_1000006 3300025258 Bacteria 777761
51 Ga0209130_1003009 3300025284 Bacteria 7625
52 Ga0209025_1000089 3300025294 Bacteria 254130
53 Ga0209758_1000016 3300025297 Bacteria 778557
54 Ga0207426_1000318 3300025302 Bacteria 93692
55 Ga0209257_1000001 3300025304 Bacteria 2274655
56 Ga0207707_10106905 3300025912 Bacteria 2446
57 Ga0207657_10056507 3300025919 Bacteria 3386
58 Ga0207681_10365582 3300025923 Bacteria 1158
59 Ga0207690_10228172 3300025932 Bacteria 1428
60 Ga0207686_10102804 3300025934 Bacteria 1911
61 Ga0207709_10000003 3300025935 Bacteria 1050072
62 Ga0207667_10297864 3300025949 Bacteria 1648
63 Ga0207702_10017576 3300026078 Bacteria 5915
64 Ga0207674_10028883 3300026116 Bacteria 5846
65 Ga0265338_10003968 3300028800 Bacteria 20378
66 Ga0265327_10000652 3300031251 Bacteria 56077
67 Ga0265327_10007539 3300031251 Bacteria 8371
68 Ga0265327_10228298 3300031251 Bacteria 835
69 Ga0307408_100000267 3300031548 Bacteria 52345
70 Ga0307414_10002505 3300032004 Bacteria 9634
71 Ga0307414_10080504 3300032004 Bacteria 2382
72 Ga0307414_10382556 3300032004 Bacteria 1217
73 Ga0307414_11060375 3300032004 Bacteria 747
74 Ga0307414_11268634 3300032004 Bacteria 683
75 Ga0395905_0000001 3300037471 Bacteria 2037079
76 Ga0395901_0007986 3300038443 Bacteria 10682
77 Ga0395901_0036868 3300038443 Bacteria 5055
78 Ga0439449_0071327 3300042007 Bacteria 1280
79 Ga0451577_0432287 3300042876 Bacteria 1195
80 Ga0453684_0004960 3300044712 Bacteria 27085
81 Ga0466959_0010948 3300045049 Bacteria 6508
82 Ga0451576_0000003 3300045051 Bacteria 1550573
83 Ga0495643_0000114 3300046522 Bacteria 131108
84 Ga0495687_097639 3300047443 Unclassified 1110
85 Ga0496101_0534091 3300048904 Bacteria 927
86 Ga0496115_0173517 3300048918 Bacteria 1783
87 Ga0496116_0000993 3300048919 Bacteria 34733
88 Ga0496117_0005004 3300048920 Bacteria 14216
89 Ga0496122_0004609 3300048925 Bacteria 16966
90 Ga0496123_0027702 3300048926 Bacteria 4214
91 Ga0496126_0008446 3300048929 Bacteria 11110
92 Ga0501033_0229362 3300049570 Bacteria 1320
93 Ga0501257_089333 3300049686 Bacteria 800
94 Ga0501241_000419 3300049758 Bacteria 9318
95 Ga0501044_0101089 3300049823 Bacteria 2901
96 Ga0500644_0000111 3300053088 Bacteria 51484
97 Ga0500646_0003549 3300053090 Bacteria 3993
98 Ga0500583_0000958 3300053092 Bacteria 8202
99 Ga0500569_001264 3300053109 Bacteria 4720
100 Ga0500607_028660 3300053121 Bacteria 3081
101 Ga0500607_029365 3300053121 Bacteria 3037
102 Ga0500658_0035634 3300053134 Bacteria 1970
103 Ga0500559_0004145 3300053136 Bacteria 6955
104 Ga0500577_0002075 3300053142 Bacteria 5115
105 Ga0500590_030446 3300053148 Bacteria 2800
106 Ga0500616_0003124 3300053153 Bacteria 12943
107 Ga0500622_0001887 3300053156 Bacteria 15831
108 Ga0500633_0011182 3300053160 Bacteria 2431
109 Ga0500636_0009069 3300053177 Bacteria 5780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047443 Ga0495687_097639 Ga0495687_097639_349_894 181
2 3300053088 Ga0500644_0000111 Ga0500644_0000111_9136_9681 181
3 3300053090 Ga0500646_0003549 Ga0500646_0003549_525_1070 181
4 3300053092 Ga0500583_0000958 Ga0500583_0000958_5563_6108 181
5 3300053109 Ga0500569_001264 Ga0500569_001264_2401_2946 181
6 3300053121 Ga0500607_029365 Ga0500607_029365_2408_2953 181
7 3300053134 Ga0500658_0035634 Ga0500658_0035634_269_814 181
8 3300053136 Ga0500559_0004145 Ga0500559_0004145_3031_3576 181
9 3300053142 Ga0500577_0002075 Ga0500577_0002075_3630_4175 181
10 3300053153 Ga0500616_0003124 Ga0500616_0003124_3770_4315 181
11 3300053160 Ga0500633_0011182 Ga0500633_0011182_223_768 181
12 3300053177 Ga0500636_0009069 Ga0500636_0009069_1656_2201 181
13 3300005539 Ga0068853_100000017 Ga0068853_100000017100 182
14 3300005841 Ga0068863_101225806 Ga0068863_1012258062 182
15 3300032004 Ga0307414_11268634 Ga0307414_112686342 182
16 3300046522 Ga0495643_0000114 Ga0495643_0000114_128605_129162 182
17 3300049686 Ga0501257_089333 Ga0501257_089333_120_671 182
18 iso_pu_bacteria 2840677318 2840677354 182
19 iso_pu_bacteria 2883068021 2883072788 182
20 iso_pu_bacteria 2896085136 2896085172 182
21 iso_pu_bacteria 2896109856 2896115099 182
22 iso_pu_bacteria 2821136567 2821137377 183
23 iso_pu_bacteria 2904467357 2904467882 183
24 iso_pu_bacteria 2919186247 2919189978 183
25 iso_pu_bacteria 2939664404 2939668258 183
26 iso_pu_bacteria 2945977869 2945978505 183
27 3300013306 Ga0163162_10685288 Ga0163162_106852882 184
28 iso_pu_bacteria 2818991460 2819680241 184
29 iso_pu_bacteria 2884791551 2884791562 184
30 iso_pu_bacteria 2890737413 2890738334 184
31 iso_pu_bacteria 2896344016 2896344794 184
32 iso_pu_bacteria 2898713307 2898715100 184
33 iso_pu_bacteria 2929177148 2929182580 184
34 iso_pu_bacteria 2929239360 2929241699 184
35 iso_pu_bacteria 2946013367 2946015633 184
36 iso_pu_bacteria 3003233435 3003234161 184
37 iso_pu_bacteria 8055588893 8055589010 184
38 3300003323 rootH1_10144560 rootH1_101445606 185
39 3300005339 Ga0070660_100040378 Ga0070660_1000403783 185
40 3300005366 Ga0070659_100053839 Ga0070659_1000538393 185
41 3300005458 Ga0070681_10405502 Ga0070681_104055022 185
42 3300005539 Ga0068853_100571896 Ga0068853_1005718961 185
43 3300013100 Ga0157373_10008857 Ga0157373_100088575 185
44 3300013102 Ga0157371_10006946 Ga0157371_100069467 185
45 3300013307 Ga0157372_10549002 Ga0157372_105490022 185
46 3300013307 Ga0157372_10868219 Ga0157372_108682192 185
47 3300025912 Ga0207707_10106905 Ga0207707_101069052 185
48 3300025919 Ga0207657_10056507 Ga0207657_100565073 185
49 3300025932 Ga0207690_10228172 Ga0207690_102281722 185
50 3300032004 Ga0307414_10002505 Ga0307414_100025052 185
51 3300038443 Ga0395901_0036868 Ga0395901_0036868_3723_4280 185
52 iso_pu_bacteria 2721755487 2722729406 185
53 iso_pu_bacteria 2904780799 2904781066 185
54 iso_pu_bacteria 2919177583 2919178562 185
55 3300003320 rootH2_10108297 rootH2_101082973 186
56 3300042876 Ga0451577_0432287 Ga0451577_0432287_21_584 186
57 iso_pu_bacteria 2896317667 2896319906 186
58 3300002773 JGI25152J39213_1000136 JGI25152J39213_10001362 187
59 3300002774 JGI25150J39212_1000008 JGI25150J39212_1000008102 187
60 3300003187 JGI25151J46595_10000014 JGI25151J46595_10000014102 187
61 3300003215 JGI25153J46596_10000020 JGI25153J46596_10000020102 187
62 3300003761 Ga0055535_1002399 Ga0055535_10023996 187
63 3300003762 Ga0055542_1005182 Ga0055542_10051824 187
64 3300005436 Ga0070713_100375645 Ga0070713_1003756452 187
65 3300013307 Ga0157372_10237856 Ga0157372_102378562 187
66 3300013307 Ga0157372_11147795 Ga0157372_111477951 187
67 3300014969 Ga0157376_10195398 Ga0157376_101953981 187
68 3300025242 Ga0209258_100145 Ga0209258_100145121 187
69 3300025245 Ga0207425_1000007 Ga0207425_100000773 187
70 3300025254 Ga0209148_1000177 Ga0209148_100017729 187
71 3300025258 Ga0209129_1000006 Ga0209129_100000673 187
72 3300025294 Ga0209025_1000089 Ga0209025_100008999 187
73 3300025297 Ga0209758_1000016 Ga0209758_100001673 187
74 3300032004 Ga0307414_10080504 Ga0307414_100805042 187
75 3300032004 Ga0307414_11060375 Ga0307414_110603751 187
76 3300038443 Ga0395901_0007986 Ga0395901_0007986_9381_9944 187
77 3300044712 Ga0453684_0004960 Ga0453684_0004960_25175_25741 187
78 3300048918 Ga0496115_0173517 Ga0496115_0173517_1016_1579 187
79 3300049570 Ga0501033_0229362 Ga0501033_0229362_693_1271 187
80 3300049823 Ga0501044_0101089 Ga0501044_0101089_857_1423 187
81 3300053148 Ga0500590_030446 Ga0500590_030446_1110_1673 187
82 3300003320 rootH2_10114990 rootH2_101149908 188
83 3300003322 rootL2_10196287 rootL2_101962874 188
84 3300003322 rootL2_10197502 rootL2_101975022 188
85 3300003323 rootH1_10013268 rootH1_100132684 188
86 3300003323 rootH1_10054302 rootH1_1005430211 188
87 3300003354 JGI25160J50197_1016254 JGI25160J50197_10162544 188
88 3300005288 Ga0065714_10230805 Ga0065714_102308051 188
89 3300005353 Ga0070669_100492919 Ga0070669_1004929192 188
90 3300005617 Ga0068859_101155109 Ga0068859_1011551092 188
91 3300006931 Ga0097620_101155112 Ga0097620_1011551122 188
92 3300009176 Ga0105242_10233150 Ga0105242_102331503 188
93 3300010375 Ga0105239_10274376 Ga0105239_102743762 188
94 3300013100 Ga0157373_10034906 Ga0157373_100349063 188
95 3300013102 Ga0157371_10090263 Ga0157371_100902633 188
96 3300013307 Ga0157372_10002418 Ga0157372_100024183 188
97 3300014326 Ga0157380_10000173 Ga0157380_1000017318 188
98 3300025208 Ga0209436_103695 Ga0209436_1036954 188
99 3300025284 Ga0209130_1003009 Ga0209130_10030096 188
100 3300025302 Ga0207426_1000318 Ga0207426_100031833 188
101 3300025304 Ga0209257_1000001 Ga0209257_1000001913 188
102 3300025923 Ga0207681_10365582 Ga0207681_103655822 188
103 3300025934 Ga0207686_10102804 Ga0207686_101028042 188
104 3300026116 Ga0207674_10028883 Ga0207674_100288833 188
105 3300031548 Ga0307408_100000267 Ga0307408_10000026727 188
106 3300032004 Ga0307414_10382556 Ga0307414_103825562 188
107 3300037471 Ga0395905_0000001 Ga0395905_0000001_1809804_1810382 188
108 3300042007 Ga0439449_0071327 Ga0439449_0071327_200_769 188
109 3300045049 Ga0466959_0010948 Ga0466959_0010948_3372_3950 188
110 3300048904 Ga0496101_0534091 Ga0496101_0534091_236_802 188
111 3300048929 Ga0496126_0008446 Ga0496126_0008446_1105_1671 188
112 3300049758 Ga0501241_000419 Ga0501241_000419_5206_5772 188
113 3300053121 Ga0500607_028660 Ga0500607_028660_1799_2371 188
114 3300053156 Ga0500622_0001887 Ga0500622_0001887_14673_15239 188
115 2162886007 SwRhRL2b_contig_3347165 SwRhRL2b_0312.00001490 189
116 3300005289 Ga0065704_10003755 Ga0065704_100037553 189
117 3300005334 Ga0068869_100215047 Ga0068869_1002150472 189
118 3300005338 Ga0068868_100119660 Ga0068868_1001196603 189
119 3300009148 Ga0105243_10000025 Ga0105243_1000002569 189
120 3300013104 Ga0157370_10135446 Ga0157370_101354463 189
121 3300025935 Ga0207709_10000003 Ga0207709_10000003857 189
122 3300025949 Ga0207667_10297864 Ga0207667_102978643 189
123 3300026078 Ga0207702_10017576 Ga0207702_100175766 189
124 3300028800 Ga0265338_10003968 Ga0265338_1000396810 189
125 3300031251 Ga0265327_10000652 Ga0265327_1000065219 189
126 3300031251 Ga0265327_10007539 Ga0265327_100075398 189
127 3300031251 Ga0265327_10228298 Ga0265327_102282982 189
128 3300045051 Ga0451576_0000003 Ga0451576_0000003_538649_539227 189
129 3300048919 Ga0496116_0000993 Ga0496116_0000993_10905_11474 189
130 3300048920 Ga0496117_0005004 Ga0496117_0005004_1152_1721 189
131 3300048925 Ga0496122_0004609 Ga0496122_0004609_14833_15402 189
132 3300048926 Ga0496123_0027702 Ga0496123_0027702_362_931 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

Flavoprotein

31

203

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m8t-assembly1.cif.gz_A crystal structure of ubix-like fmn prenyltransferase af1214 from archaeoglobus fulgidus, fmn complex 0.9509 4 186
7km2-assembly1.cif.gz_K dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9408 4 183
6m8v-assembly1.cif.gz_A crystal structure of ubix-like fmn prenyltransferase mj0101 from methanocaldococcus jannaschii, fmn complex 0.9386 5 186
7km3-assembly1.cif.gz_A dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9336 4 180
6qlg-assembly1.cif.gz_A crystal structure of anubix (pada1) in complex with fmn and dimethylallyl pyrophosphate 0.9323 3 184
ID Description Score Start End Superfamily
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.93 4 189 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9268 4 182 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9166 4 182 3.40.50.1950
1sbzC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9163 7 179 3.40.50.1950
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9157 4 189 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A4R3A5Y0-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.999 3 186 GO:0106141
AF-A0A7C5R4C9-F1-model_v4 3-octaprenyl-4-hydroxybenzoate carboxy-lyase 0.9984 4 114 GO:0003824
AF-A0A4Q5QSR5-F1-model_v4 UbiX family flavin prenyltransferase 0.9983 4 179 GO:0004659
AF-A0A1G8WMV3-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9981 2 188 GO:0106141
AF-A0A5D8YPD1-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9977 1 187 GO:0106141

Feature Viewer

pLDDT pTM Quality
95.03 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map