F152793

General Info

Members Datasets Scaffolds Average Seq Length
132 95 132 138

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10957482|Ga0163162_109574822
Length 166
Sequence VCLAACGFADQIATLFDPRSRKRGRPFGDFMALWLLKTEPDGYSWDDLARDKKATWDGVTNALALKHIRTMSKGDLALIYHTADERAAVGIAEITTAPHPDPKEDDEKLAVVDLKPKKKLKRPVTLDEFKSDKTFAGWDLLRIGRLSVVPVPQKMWDRVLELAEME

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.76
Rhizosphere 99.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10754035 3300005290 Unclassified 525
2 Ga0070658_10002921 3300005327 Bacteria 14165
3 Ga0070683_101114776 3300005329 Bacteria 758
4 Ga0070670_100758173 3300005331 Unclassified 875
5 Ga0070677_10347483 3300005333 Bacteria 767
6 Ga0070666_10033259 3300005335 Bacteria 3411
7 Ga0070666_10987000 3300005335 Unclassified 624
8 Ga0070689_100494051 3300005340 Bacteria 1047
9 Ga0070675_100040934 3300005354 Unclassified 3784
10 Ga0070675_102181057 3300005354 Unclassified 510
11 Ga0070673_100566387 3300005364 Bacteria 1033
12 Ga0070688_100189062 3300005365 Bacteria 1433
13 Ga0070667_100552725 3300005367 Bacteria 1058
14 Ga0070667_100980839 3300005367 Bacteria 788
15 Ga0070709_10724597 3300005434 Bacteria 775
16 Ga0070714_100039492 3300005435 Bacteria 3974
17 Ga0070714_100545449 3300005435 Unclassified 1110
18 Ga0070713_100134540 3300005436 Bacteria 2183
19 Ga0070685_11069816 3300005466 Unclassified 608
20 Ga0070684_100734522 3300005535 Unclassified 921
21 Ga0070672_101663186 3300005543 Unclassified 573
22 Ga0070686_101946117 3300005544 Unclassified 502
23 Ga0070665_100220738 3300005548 Bacteria 1896
24 Ga0070704_100076447 3300005549 Bacteria 2449
25 Ga0068855_100306096 3300005563 Bacteria 1759
26 Ga0068857_100004352 3300005577 Bacteria 11957
27 Ga0068857_101016567 3300005577 Unclassified 798
28 Ga0068854_100161200 3300005578 Bacteria 1737
29 Ga0068856_100152800 3300005614 Unclassified 2317
30 Ga0068856_100695933 3300005614 Bacteria 1037
31 Ga0068856_100721891 3300005614 Unclassified 1017
32 Ga0068860_100139038 3300005843 Bacteria 2333
33 Ga0081539_10012175 3300005985 Bacteria 6674
34 Ga0070717_10756864 3300006028 Bacteria 883
35 Ga0070716_100114835 3300006173 Bacteria 1675
36 Ga0075433_10722778 3300006852 Bacteria 872
37 Ga0105240_10036802 3300009093 Bacteria 6293
38 Ga0111539_10550561 3300009094 Unclassified 1344
39 Ga0105241_10135890 3300009174 Unclassified 1996
40 Ga0105248_10017583 3300009177 Bacteria 7886
41 Ga0105248_10238680 3300009177 Bacteria 2046
42 Ga0105237_11155952 3300009545 Bacteria 781
43 Ga0105238_11102769 3300009551 Bacteria 816
44 Ga0105239_10025089 3300010375 Bacteria 6567
45 Ga0157373_11294753 3300013100 Unclassified 552
46 Ga0157370_10292914 3300013104 Bacteria 1503
47 Ga0157370_10314928 3300013104 Unclassified 1444
48 Ga0157370_10334088 3300013104 Unclassified 1397
49 Ga0157370_10417653 3300013104 Bacteria 1234
50 Ga0157370_10520453 3300013104 Unclassified 1092
51 Ga0157370_10644691 3300013104 Bacteria 968
52 Ga0157369_10266445 3300013105 Bacteria 1786
53 Ga0157369_10525008 3300013105 Bacteria 1224
54 Ga0157369_10652899 3300013105 Bacteria 1085
55 Ga0157369_10714104 3300013105 Bacteria 1032
56 Ga0157369_10997562 3300013105 Bacteria 857
57 Ga0157369_11167572 3300013105 Unclassified 786
58 Ga0157374_11666924 3300013296 Unclassified 662
59 Ga0163162_10315791 3300013306 Unclassified 1695
60 Ga0163162_10957482 3300013306 Bacteria 967
61 Ga0157372_10051489 3300013307 Bacteria 4583
62 Ga0157372_10089030 3300013307 Bacteria 3506
63 Ga0157372_10571875 3300013307 Bacteria 1317
64 Ga0157372_10737174 3300013307 Bacteria 1146
65 Ga0157372_11366602 3300013307 Unclassified 817
66 Ga0157375_11403279 3300013308 Bacteria 823
67 Ga0157377_11200746 3300014745 Bacteria 587
68 Ga0157376_11581718 3300014969 Bacteria 690
69 Ga0224712_10209592 3300022467 Bacteria 888
70 Ga0207705_10006483 3300025909 Bacteria 8670
71 Ga0207705_10032081 3300025909 Bacteria 3753
72 Ga0207705_10608953 3300025909 Bacteria 849
73 Ga0207654_10155210 3300025911 Unclassified 1473
74 Ga0207695_10000211 3300025913 Bacteria 156467
75 Ga0207649_10103904 3300025920 Unclassified 1886
76 Ga0207650_11209653 3300025925 Unclassified 643
77 Ga0207659_10030403 3300025926 Bacteria 3690
78 Ga0207700_10516774 3300025928 Bacteria 1058
79 Ga0207664_10009716 3300025929 Bacteria 6763
80 Ga0207644_10229340 3300025931 Bacteria 1475
81 Ga0207690_11191164 3300025932 Bacteria 636
82 Ga0207670_10429231 3300025936 Bacteria 1062
83 Ga0207669_11070457 3300025937 Unclassified 680
84 Ga0207665_10148641 3300025939 Bacteria 1676
85 Ga0207661_11330409 3300025944 Bacteria 660
86 Ga0207667_10333219 3300025949 Bacteria 1549
87 Ga0207667_10483756 3300025949 Unclassified 1256
88 Ga0207668_10135732 3300025972 Unclassified 1885
89 Ga0207640_10820420 3300025981 Bacteria 807
90 Ga0207658_10967606 3300025986 Bacteria 776
91 Ga0207678_11227616 3300026067 Bacteria 664
92 Ga0207702_10337465 3300026078 Unclassified 1439
93 Ga0207702_11058073 3300026078 Unclassified 805
94 Ga0207676_10319381 3300026095 Bacteria 1425
95 Ga0207674_10004603 3300026116 Bacteria 16559
96 Ga0207674_10901576 3300026116 Bacteria 852
97 Ga0207674_11197576 3300026116 Unclassified 729
98 Ga0207674_12016976 3300026116 Unclassified 542
99 Ga0268266_10301545 3300028379 Bacteria 1495
100 Ga0307405_11326273 3300031731 Bacteria 627
101 Ga0307410_11287016 3300031852 Unclassified 639
102 Ga0307416_100422546 3300032002 Unclassified 1378
103 Ga0307414_12031170 3300032004 Unclassified 537
104 Ga0307415_101004115 3300032126 Bacteria 776
105 Ga0373937_0398617 3300036401 Unclassified 1306
106 Ga0373937_1262538 3300036401 Unclassified 687
107 Ga0395900_0474018 3300037418 Bacteria 1205
108 Ga0395900_0575012 3300037418 Bacteria 1069
109 Ga0395900_1520288 3300037418 Unclassified 581
110 Ga0395905_0681881 3300037471 Bacteria 930
111 Ga0395901_0028641 3300038443 Bacteria 5729
112 Ga0453684_0623679 3300044712 Bacteria 1179
113 Ga0466970_0772586 3300044765 Bacteria 562
114 Ga0451576_0297084 3300045051 Bacteria 1689
115 Ga0495629_0131824 3300046459 Bacteria 1741
116 Ga0495608_0029526 3300046511 Unclassified 3718
117 Ga0495618_0115149 3300046514 Bacteria 1721
118 Ga0495630_0267979 3300046517 Bacteria 1305
119 Ga0495652_0656497 3300046529 Unclassified 710
120 Ga0495667_0005221 3300046559 Bacteria 8777
121 Ga0495667_0169102 3300046559 Bacteria 1405
122 Ga0495635_0234881 3300046663 Bacteria 1238
123 Ga0495613_0000724 3300046689 Bacteria 25847
124 Ga0495613_0226522 3300046689 Bacteria 1311
125 Ga0495675_0232959 3300047444 Unclassified 1111
126 Ga0495684_0187226 3300047471 Bacteria 1532
127 Ga0495684_0218343 3300047471 Bacteria 1399
128 Ga0496102_0474521 3300048905 Bacteria 1172
129 nmdc:mga08y16_1622371_c1 3300050511 Bacteria 604
130 nmdc:mga08y16_880193_c1 3300050511 Unclassified 883
131 nmdc:mga0n895_230726_c1 3300050512 Bacteria 1879
132 nmdc:mga0a205_684437_c1 3300050515 Bacteria 876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_102181057 Ga0070675_1021810571 134
2 3300044712 Ga0453684_0623679 Ga0453684_0623679_453_857 134
3 3300005327 Ga0070658_10002921 Ga0070658_100029216 135
4 3300005340 Ga0070689_100494051 Ga0070689_1004940512 135
5 3300005365 Ga0070688_100189062 Ga0070688_1001890622 135
6 3300005549 Ga0070704_100076447 Ga0070704_1000764472 135
7 3300005577 Ga0068857_101016567 Ga0068857_1010165672 135
8 3300006173 Ga0070716_100114835 Ga0070716_1001148351 135
9 3300006852 Ga0075433_10722778 Ga0075433_107227782 135
10 3300013307 Ga0157372_11366602 Ga0157372_113666022 135
11 3300025909 Ga0207705_10006483 Ga0207705_100064836 135
12 3300025936 Ga0207670_10429231 Ga0207670_104292312 135
13 3300025939 Ga0207665_10148641 Ga0207665_101486411 135
14 3300026116 Ga0207674_11197576 Ga0207674_111975762 135
15 3300045051 Ga0451576_0297084 Ga0451576_0297084_1119_1526 135
16 3300050512 nmdc:mga0n895_230726_c1 nmdc:mga0n895_230726_c1_1293_1703 135
17 3300050515 nmdc:mga0a205_684437_c1 nmdc:mga0a205_684437_c1_210_620 135
18 3300005290 Ga0065712_10754035 Ga0065712_107540351 136
19 3300005329 Ga0070683_101114776 Ga0070683_1011147762 136
20 3300005331 Ga0070670_100758173 Ga0070670_1007581732 136
21 3300005333 Ga0070677_10347483 Ga0070677_103474832 136
22 3300005335 Ga0070666_10033259 Ga0070666_100332593 136
23 3300005335 Ga0070666_10987000 Ga0070666_109870001 136
24 3300005354 Ga0070675_100040934 Ga0070675_1000409345 136
25 3300005364 Ga0070673_100566387 Ga0070673_1005663871 136
26 3300005367 Ga0070667_100552725 Ga0070667_1005527252 136
27 3300005367 Ga0070667_100980839 Ga0070667_1009808392 136
28 3300005434 Ga0070709_10724597 Ga0070709_107245972 136
29 3300005435 Ga0070714_100039492 Ga0070714_1000394923 136
30 3300005435 Ga0070714_100545449 Ga0070714_1005454491 136
31 3300005436 Ga0070713_100134540 Ga0070713_1001345403 136
32 3300005466 Ga0070685_11069816 Ga0070685_110698161 136
33 3300005535 Ga0070684_100734522 Ga0070684_1007345222 136
34 3300005543 Ga0070672_101663186 Ga0070672_1016631861 136
35 3300005544 Ga0070686_101946117 Ga0070686_1019461171 136
36 3300005548 Ga0070665_100220738 Ga0070665_1002207381 136
37 3300005563 Ga0068855_100306096 Ga0068855_1003060962 136
38 3300005577 Ga0068857_100004352 Ga0068857_1000043529 136
39 3300005578 Ga0068854_100161200 Ga0068854_1001612003 136
40 3300005614 Ga0068856_100152800 Ga0068856_1001528004 136
41 3300005614 Ga0068856_100695933 Ga0068856_1006959332 136
42 3300005614 Ga0068856_100721891 Ga0068856_1007218911 136
43 3300005843 Ga0068860_100139038 Ga0068860_1001390384 136
44 3300005985 Ga0081539_10012175 Ga0081539_100121755 136
45 3300006028 Ga0070717_10756864 Ga0070717_107568642 136
46 3300009093 Ga0105240_10036802 Ga0105240_100368023 136
47 3300009094 Ga0111539_10550561 Ga0111539_105505612 136
48 3300009174 Ga0105241_10135890 Ga0105241_101358902 136
49 3300009177 Ga0105248_10017583 Ga0105248_100175839 136
50 3300009177 Ga0105248_10238680 Ga0105248_102386804 136
51 3300009545 Ga0105237_11155952 Ga0105237_111559522 136
52 3300009551 Ga0105238_11102769 Ga0105238_111027692 136
53 3300010375 Ga0105239_10025089 Ga0105239_100250897 136
54 3300013100 Ga0157373_11294753 Ga0157373_112947532 136
55 3300013104 Ga0157370_10292914 Ga0157370_102929142 136
56 3300013104 Ga0157370_10314928 Ga0157370_103149283 136
57 3300013104 Ga0157370_10334088 Ga0157370_103340882 136
58 3300013104 Ga0157370_10417653 Ga0157370_104176532 136
59 3300013104 Ga0157370_10520453 Ga0157370_105204533 136
60 3300013104 Ga0157370_10644691 Ga0157370_106446912 136
61 3300013105 Ga0157369_10266445 Ga0157369_102664452 136
62 3300013105 Ga0157369_10525008 Ga0157369_105250082 136
63 3300013105 Ga0157369_10652899 Ga0157369_106528992 136
64 3300013105 Ga0157369_10714104 Ga0157369_107141042 136
65 3300013105 Ga0157369_10997562 Ga0157369_109975622 136
66 3300013105 Ga0157369_11167572 Ga0157369_111675722 136
67 3300013296 Ga0157374_11666924 Ga0157374_116669242 136
68 3300013306 Ga0163162_10315791 Ga0163162_103157912 136
69 3300013306 Ga0163162_10957482 Ga0163162_109574822 136
70 3300013307 Ga0157372_10051489 Ga0157372_100514896 136
71 3300013307 Ga0157372_10089030 Ga0157372_100890303 136
72 3300013307 Ga0157372_10571875 Ga0157372_105718753 136
73 3300013307 Ga0157372_10737174 Ga0157372_107371742 136
74 3300013308 Ga0157375_11403279 Ga0157375_114032792 136
75 3300014745 Ga0157377_11200746 Ga0157377_112007462 136
76 3300014969 Ga0157376_11581718 Ga0157376_115817182 136
77 3300022467 Ga0224712_10209592 Ga0224712_102095922 136
78 3300025909 Ga0207705_10032081 Ga0207705_100320814 136
79 3300025909 Ga0207705_10608953 Ga0207705_106089532 136
80 3300025911 Ga0207654_10155210 Ga0207654_101552102 136
81 3300025913 Ga0207695_10000211 Ga0207695_1000021163 136
82 3300025920 Ga0207649_10103904 Ga0207649_101039042 136
83 3300025925 Ga0207650_11209653 Ga0207650_112096532 136
84 3300025926 Ga0207659_10030403 Ga0207659_100304034 136
85 3300025928 Ga0207700_10516774 Ga0207700_105167742 136
86 3300025929 Ga0207664_10009716 Ga0207664_100097162 136
87 3300025931 Ga0207644_10229340 Ga0207644_102293402 136
88 3300025932 Ga0207690_11191164 Ga0207690_111911642 136
89 3300025937 Ga0207669_11070457 Ga0207669_110704572 136
90 3300025944 Ga0207661_11330409 Ga0207661_113304092 136
91 3300025949 Ga0207667_10333219 Ga0207667_103332191 136
92 3300025949 Ga0207667_10483756 Ga0207667_104837562 136
93 3300025972 Ga0207668_10135732 Ga0207668_101357323 136
94 3300025981 Ga0207640_10820420 Ga0207640_108204202 136
95 3300025986 Ga0207658_10967606 Ga0207658_109676062 136
96 3300026067 Ga0207678_11227616 Ga0207678_112276162 136
97 3300026078 Ga0207702_10337465 Ga0207702_103374652 136
98 3300026078 Ga0207702_11058073 Ga0207702_110580732 136
99 3300026095 Ga0207676_10319381 Ga0207676_103193812 136
100 3300026116 Ga0207674_10004603 Ga0207674_100046036 136
101 3300026116 Ga0207674_10901576 Ga0207674_109015762 136
102 3300026116 Ga0207674_12016976 Ga0207674_120169761 136
103 3300028379 Ga0268266_10301545 Ga0268266_103015453 136
104 3300031731 Ga0307405_11326273 Ga0307405_113262732 136
105 3300031852 Ga0307410_11287016 Ga0307410_112870161 136
106 3300032002 Ga0307416_100422546 Ga0307416_1004225462 136
107 3300032004 Ga0307414_12031170 Ga0307414_120311701 136
108 3300032126 Ga0307415_101004115 Ga0307415_1010041152 136
109 3300036401 Ga0373937_0398617 Ga0373937_0398617_273_683 136
110 3300036401 Ga0373937_1262538 Ga0373937_1262538_48_458 136
111 3300037418 Ga0395900_0474018 Ga0395900_0474018_360_782 136
112 3300037418 Ga0395900_0575012 Ga0395900_0575012_472_891 136
113 3300037418 Ga0395900_1520288 Ga0395900_1520288_54_473 136
114 3300037471 Ga0395905_0681881 Ga0395905_0681881_447_863 136
115 3300038443 Ga0395901_0028641 Ga0395901_0028641_4659_5081 136
116 3300044765 Ga0466970_0772586 Ga0466970_0772586_112_540 136
117 3300046459 Ga0495629_0131824 Ga0495629_0131824_726_1139 136
118 3300046511 Ga0495608_0029526 Ga0495608_0029526_1592_2002 136
119 3300046514 Ga0495618_0115149 Ga0495618_0115149_53_463 136
120 3300046517 Ga0495630_0267979 Ga0495630_0267979_131_544 136
121 3300046529 Ga0495652_0656497 Ga0495652_0656497_34_444 136
122 3300046559 Ga0495667_0005221 Ga0495667_0005221_5901_6311 136
123 3300046559 Ga0495667_0169102 Ga0495667_0169102_801_1214 136
124 3300046663 Ga0495635_0234881 Ga0495635_0234881_791_1201 136
125 3300046689 Ga0495613_0000724 Ga0495613_0000724_13477_13887 136
126 3300046689 Ga0495613_0226522 Ga0495613_0226522_558_971 136
127 3300047444 Ga0495675_0232959 Ga0495675_0232959_161_571 136
128 3300047471 Ga0495684_0187226 Ga0495684_0187226_1090_1500 136
129 3300047471 Ga0495684_0218343 Ga0495684_0218343_864_1277 136
130 3300048905 Ga0496102_0474521 Ga0496102_0474521_128_541 136
131 3300050511 nmdc:mga08y16_1622371_c1 nmdc:mga08y16_1622371_c1_47_466 136
132 3300050511 nmdc:mga08y16_880193_c1 nmdc:mga08y16_880193_c1_63_488 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

32

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9375 1 135
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.932 1 134
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9243 1 135
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9125 1 134
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9095 1 134
ID Description Score Start End Superfamily
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9278 3 71 3.10.590.10
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9036 1 135 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8966 1 134 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8863 1 135 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8777 1 134 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A0P9CRQ7-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9913 1 105
AF-A0A3M0Z6I3-F1-model_v4 deleted 0.9913 2 96
AF-A0A2V7PX89-F1-model_v4 EVE domain-containing protein 0.9871 2 87
AF-A0A534RD01-F1-model_v4 EVE domain-containing protein 0.9823 2 79
AF-A0A3N0A867-F1-model_v4 EVE domain-containing protein 0.9755 3 85

Feature Viewer

pLDDT pTM Quality
92.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map