F151544

General Info

Members Datasets Scaffolds Average Seq Length
132 103 264 338

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100196611|Ga0070683_1001966111
Length 390
Sequence MTVDRICTGVRMHKCEGRFYAVPRQRKEFCVSDPINYRSHGLVSADDLALAYADFDVLDTLDATLGGNAASEGNFPSLEGATTWLNSAPLTPEALRGKVVAVDFWTYTCINWLRTLPFLRAWAKKYQDHGLVVIGVHTPEFPFEHDLENVRRAMKDMQVDYPVAVDNDYRIWSAFNNHYWPALYLVDAQGRIRHHQFGEGDYEEAEHRIQQLLADAGDESAGYELVTLDAHGPEVAADWDDLGSGENYVGYARTDGFASPEGAVVDERHIYMIPVRLSRNEWALEGEWTMERGFAALHAANGRIAYRFHARDLHLVMGPATPGSSVRFRVRLDGKAPGAAHGSDVDAQGEGVASEQRLHQLIRQPGSIADRTFEIEFLDPGVEAYAFTFG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
103 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.7
Metatranscriptomes 4.55
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.55
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100196611 3300005329 Bacteria 1915
2 rootL2_10120974 3300003322 Bacteria 4838
3 Ga0070658_10332180 3300005327 Bacteria 1299
4 Ga0070683_100001370 3300005329 Bacteria 18667
5 Ga0070660_100053492 3300005339 Bacteria 3114
6 Ga0070660_100434245 3300005339 Bacteria 1088
7 Ga0070691_10051421 3300005341 Bacteria 1967
8 Ga0070668_100017559 3300005347 Bacteria 5365
9 Ga0070674_100121492 3300005356 Bacteria 1934
10 Ga0070667_100049013 3300005367 Bacteria 3557
11 Ga0070705_100032078 3300005440 Bacteria 2916
12 Ga0070694_100022127 3300005444 Bacteria 4071
13 Ga0070708_100071572 3300005445 Bacteria 3122
14 Ga0070663_100354810 3300005455 Bacteria 1188
15 Ga0070681_10147898 3300005458 Bacteria 2277
16 Ga0070706_100000568 3300005467 Bacteria 43152
17 Ga0070706_100001510 3300005467 Bacteria 24415
18 Ga0070706_100056077 3300005467 Unclassified 3636
19 Ga0070707_100023468 3300005468 Bacteria 5836
20 Ga0070707_100038381 3300005468 Bacteria 4574
21 Ga0070707_100100628 3300005468 Bacteria 2801
22 Ga0070698_100033003 3300005471 Bacteria 5362
23 Ga0070699_100012108 3300005518 Bacteria 7445
24 Ga0070699_100110013 3300005518 Bacteria 2419
25 Ga0070679_100186631 3300005530 Bacteria 2044
26 Ga0070679_100215764 3300005530 Bacteria 1881
27 Ga0070679_100336277 3300005530 Bacteria 1458
28 Ga0070684_100155296 3300005535 Bacteria 2075
29 Ga0070697_100028265 3300005536 Bacteria 4490
30 Ga0070697_100086557 3300005536 Bacteria 2586
31 Ga0070695_100003371 3300005545 Bacteria 9338
32 Ga0070696_100013902 3300005546 Bacteria 5404
33 Ga0070665_100468193 3300005548 Bacteria 1271
34 Ga0068855_100219343 3300005563 Bacteria 2133
35 Ga0068855_100581880 3300005563 Bacteria 1209
36 Ga0068857_100004933 3300005577 Bacteria 11327
37 Ga0068856_100035807 3300005614 Bacteria 4865
38 Ga0068858_100229234 3300005842 Bacteria 1761
39 Ga0068860_100101029 3300005843 Bacteria 2752
40 Ga0081455_10017238 3300005937 Bacteria 6934
41 Ga0081538_10056565 3300005981 Bacteria 2296
42 Ga0070717_10195734 3300006028 Bacteria 1768
43 Ga0075428_100000391 3300006844 Bacteria 43274
44 Ga0075428_100014714 3300006844 Bacteria 8689
45 Ga0075431_100000024 3300006847 Bacteria 79167
46 Ga0075429_100002133 3300006880 Bacteria 16511
47 Ga0075435_100071512 3300007076 Bacteria 2833
48 Ga0111539_10000102 3300009094 Bacteria 91214
49 Ga0111539_10006288 3300009094 Bacteria 15332
50 Ga0105245_10036522 3300009098 Bacteria 4365
51 Ga0114129_10010554 3300009147 Bacteria 13171
52 Ga0114129_10111635 3300009147 Bacteria 3772
53 Ga0114129_10152661 3300009147 Bacteria 3160
54 Ga0105237_10046818 3300009545 Bacteria 4349
55 Ga0105237_10178721 3300009545 Bacteria 2122
56 Ga0157373_10034755 3300013100 Bacteria 3620
57 Ga0157369_10042143 3300013105 Bacteria 4981
58 Ga0157372_10446437 3300013307 Bacteria 1507
59 Ga0163163_10062826 3300014325 Bacteria 3681
60 Ga0197907_10639011 3300020069 Bacteria 2591
61 Ga0206352_11228791 3300020078 Bacteria 1902
62 Ga0206350_11266517 3300020080 Bacteria 4799
63 Ga0206354_10615373 3300020081 Bacteria 4653
64 Ga0206353_10814434 3300020082 Bacteria 2772
65 Ga0224712_10001956 3300022467 Bacteria 4977
66 Ga0207705_10252167 3300025909 Bacteria 1346
67 Ga0207684_10000598 3300025910 Bacteria 43142
68 Ga0207684_10001562 3300025910 Bacteria 24462
69 Ga0207684_10014257 3300025910 Bacteria 6857
70 Ga0207684_10015820 3300025910 Bacteria 6486
71 Ga0207707_10133562 3300025912 Bacteria 2170
72 Ga0207707_10209650 3300025912 Bacteria 1698
73 Ga0207657_10004733 3300025919 Bacteria 14367
74 Ga0207657_10008195 3300025919 Bacteria 10647
75 Ga0207652_10213143 3300025921 Bacteria 1740
76 Ga0207646_10060626 3300025922 Bacteria 3378
77 Ga0207646_10080266 3300025922 Bacteria 2917
78 Ga0207664_10034120 3300025929 Bacteria 3916
79 Ga0207668_10071103 3300025972 Bacteria 2484
80 Ga0207677_10123446 3300026023 Bacteria 1953
81 Ga0207702_10031013 3300026078 Bacteria 4456
82 Ga0207641_10176272 3300026088 Bacteria 1955
83 Ga0207676_10073097 3300026095 Bacteria 2758
84 Ga0207674_10024881 3300026116 Bacteria 6390
85 Ga0207428_10002545 3300027907 Bacteria 18205
86 Ga0268266_10328824 3300028379 Bacteria 1432
87 Ga0268264_10123507 3300028381 Bacteria 2285
88 Ga0307509_10013233 3300031507 Bacteria 9789
89 Ga0307413_10150934 3300031824 Bacteria 1619
90 Ga0307410_10081851 3300031852 Bacteria 2269
91 Ga0307406_10043795 3300031901 Bacteria 2801
92 Ga0307406_10054894 3300031901 Bacteria 2544
93 Ga0307407_10262809 3300031903 Bacteria 1188
94 Ga0307412_10181082 3300031911 Bacteria 1585
95 Ga0307409_100067492 3300031995 Bacteria 2824
96 Ga0307409_100138947 3300031995 Bacteria 2090
97 Ga0307409_100227440 3300031995 Bacteria 1688
98 Ga0307414_10211123 3300032004 Bacteria 1587
99 Ga0307507_10035559 3300033179 Bacteria 5115
100 Ga0307510_10002187 3300033180 Bacteria 22098
101 Ga0373953_0030860 3300035117 Bacteria 2081
102 Ga0373935_0230294 3300035692 Bacteria 1290
103 Ga0373933_0096258 3300035724 Bacteria 1832
104 Ga0373937_0101598 3300036401 Bacteria 2669
105 Ga0395901_0395439 3300038443 Bacteria 1420
106 Ga0450908_001794 3300042184 Bacteria 4190
107 Ga0451576_0567613 3300045051 Bacteria 1192
108 Ga0495651_0066558 3300046462 Bacteria 2750
109 Ga0495584_0023575 3300046491 Bacteria 3120
110 Ga0495606_0002671 3300046507 Bacteria 20238
111 Ga0495630_0089243 3300046517 Bacteria 2329
112 Ga0495668_0071025 3300046616 Bacteria 1914
113 Ga0495613_0042476 3300046689 Bacteria 3364
114 Ga0495684_0247590 3300047471 Bacteria 1298
115 Ga0496102_0037538 3300048905 Bacteria 4371
116 Ga0496104_0056598 3300048907 Bacteria 3709
117 Ga0496109_0285098 3300048912 Bacteria 1557
118 Ga0496110_0301799 3300048913 Bacteria 1459
119 Ga0496112_0004863 3300048915 Bacteria 11481
120 Ga0496112_0039476 3300048915 Bacteria 4614
121 Ga0501036_0448689 3300049572 Bacteria 1075
122 Ga0501249_017401 3300049679 Bacteria 1549
123 nmdc:mga05p37_8204_c1 3300050507 Bacteria 12349
124 nmdc:mga05p37_91454_c2 3300050507 Bacteria 3096
125 nmdc:mga09592_657_c1 3300050508 Bacteria 26324
126 nmdc:mga06r32_100492_c1 3300050510 Bacteria 2838
127 nmdc:mga06r32_11_c1 3300050510 Bacteria 111691
128 nmdc:mga08y16_438_c1 3300050511 Bacteria 38388
129 nmdc:mga08y16_7007_c1 3300050511 Bacteria 11820
130 nmdc:mga0rr50_144565_c1 3300050513 Bacteria 1916
131 Ga0495612_0110163 3300053078 Bacteria 1178
132 2753265688 2751185782 Bacteria 11227053
133 Ga0070683_100196611
134 rootL2_10120974
135 Ga0070658_10332180
136 Ga0070683_100001370
137 Ga0070660_100053492
138 Ga0070660_100434245
139 Ga0070691_10051421
140 Ga0070668_100017559
141 Ga0070674_100121492
142 Ga0070667_100049013
143 Ga0070705_100032078
144 Ga0070694_100022127
145 Ga0070708_100071572
146 Ga0070663_100354810
147 Ga0070681_10147898
148 Ga0070706_100000568
149 Ga0070706_100001510
150 Ga0070706_100056077
151 Ga0070707_100023468
152 Ga0070707_100038381
153 Ga0070707_100100628
154 Ga0070698_100033003
155 Ga0070699_100012108
156 Ga0070699_100110013
157 Ga0070679_100186631
158 Ga0070679_100215764
159 Ga0070679_100336277
160 Ga0070684_100155296
161 Ga0070697_100028265
162 Ga0070697_100086557
163 Ga0070695_100003371
164 Ga0070696_100013902
165 Ga0070665_100468193
166 Ga0068855_100219343
167 Ga0068855_100581880
168 Ga0068857_100004933
169 Ga0068856_100035807
170 Ga0068858_100229234
171 Ga0068860_100101029
172 Ga0081455_10017238
173 Ga0081538_10056565
174 Ga0070717_10195734
175 Ga0075428_100000391
176 Ga0075428_100014714
177 Ga0075431_100000024
178 Ga0075429_100002133
179 Ga0075435_100071512
180 Ga0111539_10000102
181 Ga0111539_10006288
182 Ga0105245_10036522
183 Ga0114129_10010554
184 Ga0114129_10111635
185 Ga0114129_10152661
186 Ga0105237_10046818
187 Ga0105237_10178721
188 Ga0157373_10034755
189 Ga0157369_10042143
190 Ga0157372_10446437
191 Ga0163163_10062826
192 Ga0197907_10639011
193 Ga0206352_11228791
194 Ga0206350_11266517
195 Ga0206354_10615373
196 Ga0206353_10814434
197 Ga0224712_10001956
198 Ga0207705_10252167
199 Ga0207684_10000598
200 Ga0207684_10001562
201 Ga0207684_10014257
202 Ga0207684_10015820
203 Ga0207707_10133562
204 Ga0207707_10209650
205 Ga0207657_10004733
206 Ga0207657_10008195
207 Ga0207652_10213143
208 Ga0207646_10060626
209 Ga0207646_10080266
210 Ga0207664_10034120
211 Ga0207668_10071103
212 Ga0207677_10123446
213 Ga0207702_10031013
214 Ga0207641_10176272
215 Ga0207676_10073097
216 Ga0207674_10024881
217 Ga0207428_10002545
218 Ga0268266_10328824
219 Ga0268264_10123507
220 Ga0307509_10013233
221 Ga0307413_10150934
222 Ga0307410_10081851
223 Ga0307406_10043795
224 Ga0307406_10054894
225 Ga0307407_10262809
226 Ga0307412_10181082
227 Ga0307409_100067492
228 Ga0307409_100138947
229 Ga0307409_100227440
230 Ga0307414_10211123
231 Ga0307507_10035559
232 Ga0307510_10002187
233 Ga0373953_0030860
234 Ga0373935_0230294
235 Ga0373933_0096258
236 Ga0373937_0101598
237 Ga0395901_0395439
238 Ga0450908_001794
239 Ga0451576_0567613
240 Ga0495651_0066558
241 Ga0495584_0023575
242 Ga0495606_0002671
243 Ga0495630_0089243
244 Ga0495668_0071025
245 Ga0495613_0042476
246 Ga0495684_0247590
247 Ga0496102_0037538
248 Ga0496104_0056598
249 Ga0496109_0285098
250 Ga0496110_0301799
251 Ga0496112_0004863
252 Ga0496112_0039476
253 Ga0501036_0448689
254 Ga0501249_017401
255 nmdc:mga05p37_8204_c1
256 nmdc:mga05p37_91454_c2
257 nmdc:mga09592_657_c1
258 nmdc:mga06r32_100492_c1
259 nmdc:mga06r32_11_c1
260 nmdc:mga08y16_438_c1
261 nmdc:mga08y16_7007_c1
262 nmdc:mga0rr50_144565_c1
263 Ga0495612_0110163
264 2753265688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17991

Thioredoxin_10

Thioredoxin like C-terminal domain

244

390

0.99

PF00578

AhpC-TSA

AhpC/TSA family

74

195

0.91

PF13905

Thioredoxin_8

Thioredoxin-like

97

192

0.9

PF08534

Redoxin

Redoxin

70

213

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eyt-assembly1.cif.gz_B crystal structure of thioredoxin-like superfamily protein spoa0173 0.901 16 158
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.8922 12 156
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.891 17 155
5cyy-assembly2.cif.gz_C structure of the c-terminal domains of dipz from mycobacterium tuberculosis 0.8837 12 328
2hyx-assembly2.cif.gz_D structure of the c-terminal domain of dipz from mycobacterium tuberculosis 0.8837 8 328
ID Description Score Start End Superfamily
af_Q9W5T4_48_199_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9524 26 157 3.40.30.10
af_Q8VZ10_367_538_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9061 12 157 3.40.30.10
af_Q2G203_11_180_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8872 41 80 3.40.30.10
5cyyD02 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8817 183 327 2.60.120.260
af_Q8BZW8_26_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8722 3 157 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A529ME08-F1-model_v4 Redoxin domain-containing protein 1 38 118 GO:0016491
AF-A0A537U1I5-F1-model_v4 Redoxin domain-containing protein 0.9964 37 157 GO:0016209
GO:0016491
AF-A0A2V8IK74-F1-model_v4 DipZ thioredoxin-like C-terminal domain-containing protein 0.9939 243 328
AF-A0A1L3EPS0-F1-model_v4 Thioredoxin domain-containing protein 0.9921 18 328 GO:0016209
GO:0016491
AF-A0A2T5XC57-F1-model_v4 deleted 0.991 36 156

Map