F149953

General Info

Members Datasets Scaffolds Average Seq Length
131 86 262 245

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0019500|Ga0395900_0019500_110_931
Length 273
Sequence MDERNGGDERDAGATPRDVVAALAEVADAGDAAFLQRFFKTAPGEYGEGDVFIGVRVPALRAVVKRLGPLSFEAIADLLSSPVHEHRLAGLVALNALFARASASRTRDDEQRERLAAFYLNAVRAGRVNNWDLVDASAEFVLGEYLVDCPRFVLFELADADDLWWRRVAMLSTFAFIKRGDASTTLELASRVLEAGDRRDLTQKAVGWMLREVGKRVDRTLLTGFLDDNAARMPATMLSYATEHLDPLARAAYRARRLAAAVPHALGSGSSVG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
16 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
19 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
20 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
21 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
22 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
23 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
24 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
25 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
26 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
27 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
28 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
29 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
30 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
31 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
32 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
33 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
34 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
35 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
36 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
37 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
38 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
39 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
40 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
41 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
42 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
43 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
45 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
46 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
54 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
55 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
56 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
57 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
58 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
59 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
60 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
61 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
62 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
65 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
66 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
67 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
68 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
69 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
70 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
71 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
72 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
73 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
74 2547132424 Nocardia nova SH22a Isolate Unclassified
75 2643221616 Leifsonia sp. Root227 Isolate Unclassified
76 2643221619 Agromyces sp. Root81 Isolate Unclassified
77 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
78 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
79 2808606372 Agromyces sp. 23-23 Isolate Unclassified
80 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
81 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
82 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
83 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
84 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
85 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
86 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.08
Metatranscriptomes 0
Isolates 9.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.45
Nodule 0
Rhizoplane 2.29
Rhizosphere 77.1
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0019500 3300037418 Bacteria 6914
2 SwRhRL2b_contig_1874099 2162886007 Bacteria 355736
3 JGI24737J22298_10000709 3300001990 Bacteria 11732
4 JGI24735J21928_10000111 3300002067 Bacteria 29556
5 Ga0065704_10070138 3300005289 Bacteria 546071
6 Ga0070683_100500393 3300005329 Bacteria 1161
7 Ga0070714_100133902 3300005435 Bacteria 2217
8 Ga0070705_100406402 3300005440 Bacteria 1010
9 Ga0070665_100538292 3300005548 Bacteria 1180
10 Ga0068861_100116529 3300005719 Bacteria 2148
11 Ga0075366_10299163 3300006195 Bacteria 984
12 Ga0105243_10001114 3300009148 Bacteria 24391
13 Ga0105033_100153 3300009986 Bacteria 5235
14 Ga0157369_10185627 3300013105 Bacteria 2187
15 Ga0163163_10059303 3300014325 Unclassified 3785
16 Ga0207675_100266255 3300026118 Bacteria 1662
17 Ga0268266_10450065 3300028379 Bacteria 1224
18 Ga0265327_10047898 3300031251 Bacteria 2251
19 Ga0373927_0125963 3300035695 Bacteria 1672
20 Ga0373927_0262692 3300035695 Bacteria 1135
21 Ga0373947_0169605 3300035725 Bacteria 1415
22 Ga0373925_0037869 3300037068 Bacteria 3562
23 Ga0395901_0096976 3300038443 Bacteria 3090
24 Ga0400490_35034 3300038726 Bacteria 1909
25 Ga0400488_06969 3300038741 Bacteria 8284
26 Ga0400487_06296 3300039110 Bacteria 48816
27 Ga0451793_0845942 3300041452 Bacteria 3636
28 Ga0451797_0319794 3300041453 Bacteria 931
29 Ga0451807_1339474 3300041486 Unclassified 3026
30 Ga0495650_0117943 3300046471 Bacteria 979
31 Ga0495639_0034890 3300046475 Unclassified 2250
32 Ga0495630_0022769 3300046517 Bacteria 4628
33 Ga0495648_0125459 3300046524 Bacteria 1373
34 Ga0495665_0033897 3300046531 Bacteria 2730
35 Ga0495640_0223777 3300046533 Bacteria 1186
36 Ga0495586_0012901 3300046535 Bacteria 4431
37 Ga0495586_0019609 3300046535 Bacteria 3601
38 Ga0495588_0098244 3300046674 Bacteria 1537
39 Ga0495581_0023690 3300047315 Bacteria 3557
40 Ga0495581_0025747 3300047315 Bacteria 3411
41 Ga0495581_0223896 3300047315 Bacteria 1100
42 Ga0495674_0110934 3300047319 Bacteria 2325
43 Ga0495674_0155049 3300047319 Bacteria 1919
44 Ga0495672_0000323 3300047320 Bacteria 63547
45 Ga0496126_0021575 3300048929 Bacteria 6288
46 Ga0501031_0154454 3300049568 Bacteria 1500
47 Ga0501031_0221995 3300049568 Bacteria 1230
48 Ga0501032_0047526 3300049569 Bacteria 2897
49 Ga0501032_0178053 3300049569 Bacteria 1393
50 Ga0501033_0002192 3300049570 Bacteria 16863
51 Ga0501033_0007336 3300049570 Bacteria 8591
52 Ga0501034_0001515 3300049571 Bacteria 30517
53 Ga0501034_0014121 3300049571 Bacteria 8230
54 Ga0501034_0074312 3300049571 Bacteria 3407
55 Ga0501034_0082681 3300049571 Bacteria 3213
56 Ga0501034_0087267 3300049571 Bacteria 3119
57 Ga0501034_0195212 3300049571 Bacteria 1984
58 Ga0501034_0226687 3300049571 Bacteria 1819
59 Ga0501034_0901208 3300049571 Bacteria 772
60 Ga0501036_0018526 3300049572 Bacteria 5835
61 Ga0501037_0001778 3300049573 Bacteria 15648
62 Ga0501037_0022460 3300049573 Bacteria 4667
63 Ga0501037_0084257 3300049573 Bacteria 2302
64 Ga0501038_0075292 3300049574 Bacteria 2853
65 Ga0501042_0036448 3300049578 Bacteria 3490
66 Ga0501042_0112086 3300049578 Bacteria 1964
67 Ga0501043_0002620 3300049579 Bacteria 15164
68 Ga0501043_0016686 3300049579 Bacteria 5754
69 Ga0501043_0086431 3300049579 Bacteria 2464
70 Ga0501043_0254988 3300049579 Bacteria 1350
71 Ga0501046_0003975 3300049580 Bacteria 13494
72 Ga0501046_0061439 3300049580 Bacteria 2937
73 Ga0501046_0312786 3300049580 Bacteria 1145
74 Ga0501046_0342063 3300049580 Bacteria 1087
75 Ga0501047_0000714 3300049581 Bacteria 34622
76 Ga0501047_0024395 3300049581 Bacteria 5805
77 Ga0501047_0060031 3300049581 Bacteria 3671
78 Ga0501047_0300127 3300049581 Bacteria 1449
79 Ga0501048_0036237 3300049582 Bacteria 3546
80 Ga0501048_0115400 3300049582 Bacteria 1897
81 Ga0501048_0149599 3300049582 Bacteria 1651
82 Ga0501069_0028442 3300049585 Bacteria 3065
83 Ga0501070_0001579 3300049586 Bacteria 20257
84 Ga0501070_0005145 3300049586 Bacteria 11144
85 Ga0501070_0199362 3300049586 Bacteria 1644
86 Ga0501070_0279344 3300049586 Bacteria 1363
87 Ga0501070_0290475 3300049586 Bacteria 1333
88 Ga0501071_0015773 3300049587 Bacteria 5189
89 Ga0501071_0090927 3300049587 Bacteria 2242
90 Ga0501072_0074775 3300049588 Bacteria 2679
91 Ga0501072_0138224 3300049588 Bacteria 1943
92 Ga0501074_0025350 3300049590 Bacteria 4307
93 Ga0501076_0250888 3300049592 Bacteria 1448
94 Ga0501079_0423558 3300049741 Bacteria 1045
95 Ga0501079_0617972 3300049741 Bacteria 853
96 Ga0501080_0000085 3300049742 Bacteria 62675
97 Ga0501083_0003278 3300049744 Bacteria 11305
98 Ga0501035_0000853 3300049822 Bacteria 32534
99 Ga0501035_0028240 3300049822 Bacteria 5121
100 Ga0501035_0091311 3300049822 Bacteria 2680
101 Ga0501035_0229218 3300049822 Bacteria 1583
102 Ga0501044_0001079 3300049823 Bacteria 32595
103 Ga0501044_0014913 3300049823 Bacteria 8378
104 Ga0501045_0095349 3300049824 Bacteria 2201
105 nmdc:mga0k408_9190_c1 3300050493 Bacteria 5325
106 Ga0500635_0000138 3300053080 Bacteria 41788
107 Ga0500650_0001936 3300053098 Bacteria 6571
108 Ga0500561_0000001 3300053137 Bacteria 957685
109 Ga0500568_0009230 3300053139 Bacteria 4701
110 Ga0500568_0011314 3300053139 Bacteria 4149
111 Ga0500573_0000437 3300053140 Bacteria 17885
112 Ga0500573_0019340 3300053140 Bacteria 3896
113 Ga0500573_0239120 3300053140 Bacteria 942
114 Ga0500577_0001776 3300053142 Bacteria 5512
115 Ga0500577_0193764 3300053142 Bacteria 875
116 Ga0500616_0000242 3300053153 Bacteria 85918
117 Ga0500616_0005840 3300053153 Bacteria 8245
118 Ga0500620_042912 3300053155 Bacteria 1492
119 2548699128 2547132424 Bacteria 8348532
120 2644097786 2643221616 Bacteria 4066575
121 2644112680 2643221619 Bacteria 4158469
122 2739204412 2738543005 Bacteria 5278128
123 2739236790 2738543011 Bacteria 5731169
124 2808900298 2808606372 Bacteria 4649509
125 2870625449 2870622029 Bacteria 3643329
126 2889305683 2889300758 Bacteria 5690814
127 2919444878 2919443155 Bacteria 4072969
128 2919717090 2919713450 Bacteria 7431245
129 2928145235 2928142448 Bacteria 5288925
130 2939660554 2939657138 Bacteria 3740283
131 2939743818 2939743619 Bacteria 5762299
132 Ga0395900_0019500
133 SwRhRL2b_contig_1874099
134 JGI24737J22298_10000709
135 JGI24735J21928_10000111
136 Ga0065704_10070138
137 Ga0070683_100500393
138 Ga0070714_100133902
139 Ga0070705_100406402
140 Ga0070665_100538292
141 Ga0068861_100116529
142 Ga0075366_10299163
143 Ga0105243_10001114
144 Ga0105033_100153
145 Ga0157369_10185627
146 Ga0163163_10059303
147 Ga0207675_100266255
148 Ga0268266_10450065
149 Ga0265327_10047898
150 Ga0373927_0125963
151 Ga0373927_0262692
152 Ga0373947_0169605
153 Ga0373925_0037869
154 Ga0395901_0096976
155 Ga0400490_35034
156 Ga0400488_06969
157 Ga0400487_06296
158 Ga0451793_0845942
159 Ga0451797_0319794
160 Ga0451807_1339474
161 Ga0495650_0117943
162 Ga0495639_0034890
163 Ga0495630_0022769
164 Ga0495648_0125459
165 Ga0495665_0033897
166 Ga0495640_0223777
167 Ga0495586_0012901
168 Ga0495586_0019609
169 Ga0495588_0098244
170 Ga0495581_0023690
171 Ga0495581_0025747
172 Ga0495581_0223896
173 Ga0495674_0110934
174 Ga0495674_0155049
175 Ga0495672_0000323
176 Ga0496126_0021575
177 Ga0501031_0154454
178 Ga0501031_0221995
179 Ga0501032_0047526
180 Ga0501032_0178053
181 Ga0501033_0002192
182 Ga0501033_0007336
183 Ga0501034_0001515
184 Ga0501034_0014121
185 Ga0501034_0074312
186 Ga0501034_0082681
187 Ga0501034_0087267
188 Ga0501034_0195212
189 Ga0501034_0226687
190 Ga0501034_0901208
191 Ga0501036_0018526
192 Ga0501037_0001778
193 Ga0501037_0022460
194 Ga0501037_0084257
195 Ga0501038_0075292
196 Ga0501042_0036448
197 Ga0501042_0112086
198 Ga0501043_0002620
199 Ga0501043_0016686
200 Ga0501043_0086431
201 Ga0501043_0254988
202 Ga0501046_0003975
203 Ga0501046_0061439
204 Ga0501046_0312786
205 Ga0501046_0342063
206 Ga0501047_0000714
207 Ga0501047_0024395
208 Ga0501047_0060031
209 Ga0501047_0300127
210 Ga0501048_0036237
211 Ga0501048_0115400
212 Ga0501048_0149599
213 Ga0501069_0028442
214 Ga0501070_0001579
215 Ga0501070_0005145
216 Ga0501070_0199362
217 Ga0501070_0279344
218 Ga0501070_0290475
219 Ga0501071_0015773
220 Ga0501071_0090927
221 Ga0501072_0074775
222 Ga0501072_0138224
223 Ga0501074_0025350
224 Ga0501076_0250888
225 Ga0501079_0423558
226 Ga0501079_0617972
227 Ga0501080_0000085
228 Ga0501083_0003278
229 Ga0501035_0000853
230 Ga0501035_0028240
231 Ga0501035_0091311
232 Ga0501035_0229218
233 Ga0501044_0001079
234 Ga0501044_0014913
235 Ga0501045_0095349
236 nmdc:mga0k408_9190_c1
237 Ga0500635_0000138
238 Ga0500650_0001936
239 Ga0500561_0000001
240 Ga0500568_0009230
241 Ga0500568_0011314
242 Ga0500573_0000437
243 Ga0500573_0019340
244 Ga0500573_0239120
245 Ga0500577_0001776
246 Ga0500577_0193764
247 Ga0500616_0000242
248 Ga0500616_0005840
249 Ga0500620_042912
250 2548699128
251 2644097786
252 2644112680
253 2739204412
254 2739236790
255 2808900298
256 2870625449
257 2889305683
258 2919444878
259 2919717090
260 2928145235
261 2939660554
262 2939743818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08713

DNA_alkylation

DNA alkylation repair enzyme

19

245

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.8242 4 221
5cl3-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (100% substrate at 4 hours) 0.7851 4 228
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.7806 4 221
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.7697 11 222
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.7502 11 222
ID Description Score Start End Superfamily
5clcA00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant; 0.8242 4 221 1.25.10.90
5clcA00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant; 0.7806 4 221 1.25.10.90
af_O77327_1091_1211_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6893 129 225 1.25.10.10
af_Q10178_911_1031_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.647 128 226 1.25.10.10
af_G5EEQ8_1010_1148_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6311 121 226 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A2G9MDR2-F1-model_v4 DNA alkylation repair protein 0.9979 2 149
AF-A0A2U3QJY0-F1-model_v4 DNA alkylation repair enzyme 0.9962 2 230
AF-A0A6A7MTI9-F1-model_v4 deleted 0.9962 141 235
AF-A0A0G0BKA9-F1-model_v4 DNA alkylation repair protein 0.9936 3 230
AF-A0A7C3K5I7-F1-model_v4 DNA alkylation repair protein 0.9935 130 231

Map