F147358

General Info

Members Datasets Scaffolds Average Seq Length
130 94 260 161

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2775506925|2776376927
Length 190
Sequence IRLTGGVPGEAGRFYTLRHGFRVISPPVSNVKVLLTRLDPDVPLPAYAKPGDAGADLVTTSDVVLEPGERAVVGTGIAVALPEGYAGFVHPRSGLAAKAGLSVVNAPGTVDSGYRGEIKVCLVNHDRAVPLSLRRGDRIAQLVVQKVEHAVFQEVEELPASQRGAGGYGSTGGHEVLAVSGVEAGHRTEV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
26 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
38 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
39 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
40 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
41 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
57 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
58 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
78 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
79 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
80 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
81 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
82 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
83 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
84 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
85 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
86 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
87 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
88 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
89 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
90 2920879853 Kocuria salina CV6 Isolate Unclassified
91 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
92 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
93 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
94 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0.77
Isolates 9.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 2.31
Rhizosphere 82.31
Stem 0
Stem Tuber 0.77
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000865 3300003203 Bacteria 14261
2 JGI25406J46586_10031945 3300003203 Bacteria 1963
3 JGI25407J50210_10075971 3300003373 Bacteria 836
4 Ga0070658_10098664 3300005327 Bacteria 2413
5 Ga0070659_100005467 3300005366 Bacteria 9129
6 Ga0070714_100001959 3300005435 Bacteria 15034
7 Ga0070710_10000295 3300005437 Bacteria 23570
8 Ga0070663_100350101 3300005455 Bacteria 1196
9 Ga0070698_100010407 3300005471 Bacteria 9934
10 Ga0070684_101031489 3300005535 Bacteria 772
11 Ga0070684_101176781 3300005535 Bacteria 721
12 Ga0070665_100394883 3300005548 Bacteria 1391
13 Ga0068861_100276953 3300005719 Bacteria 1443
14 Ga0081455_10000105 3300005937 Bacteria 93356
15 Ga0081455_10129736 3300005937 Bacteria 1973
16 Ga0081538_10000005 3300005981 Bacteria 187304
17 Ga0081539_10000100 3300005985 Bacteria 199516
18 Ga0081539_10000196 3300005985 Bacteria 140882
19 Ga0070717_10133433 3300006028 Bacteria 2137
20 Ga0075430_100525670 3300006846 Bacteria 976
21 Ga0097620_101120640 3300006931 Bacteria 866
22 Ga0111539_10664412 3300009094 Bacteria 1213
23 Ga0105237_10183501 3300009545 Bacteria 2092
24 Ga0105238_10057719 3300009551 Bacteria 3891
25 Ga0105249_11465339 3300009553 Bacteria 755
26 Ga0157371_10027370 3300013102 Bacteria 4136
27 Ga0163163_11331888 3300014325 Bacteria 780
28 Ga0157380_11987481 3300014326 Bacteria 643
29 Ga0213874_10265934 3300021377 Bacteria 636
30 Ga0207692_10000144 3300025898 Bacteria 22086
31 Ga0207705_10000947 3300025909 Bacteria 23695
32 Ga0207705_10137273 3300025909 Bacteria 1824
33 Ga0207660_10029828 3300025917 Bacteria 3746
34 Ga0207694_10035472 3300025924 Bacteria 3827
35 Ga0207664_10005563 3300025929 Bacteria 8629
36 Ga0207664_10024856 3300025929 Bacteria 4504
37 Ga0207664_10086106 3300025929 Bacteria 2566
38 Ga0207690_10018007 3300025932 Bacteria 4326
39 Ga0207690_10957106 3300025932 Bacteria 711
40 Ga0207669_10254257 3300025937 Bacteria 1310
41 Ga0207667_10615650 3300025949 Bacteria 1094
42 Ga0207639_10052136 3300026041 Bacteria 3116
43 Ga0207678_10663184 3300026067 Bacteria 917
44 Ga0307515_10045190 3300028794 Bacteria 6774
45 Ga0316177_1183956 3300030731 Bacteria 2774
46 Ga0316176_1031107 3300030732 Bacteria 13334
47 Ga0314311_1030145 3300030733 Bacteria 5102
48 Ga0316179_1012584 3300030734 Bacteria 936
49 Ga0316180_1006041 3300030736 Bacteria 2820
50 Ga0307513_10006937 3300031456 Bacteria 14741
51 Ga0307509_10250326 3300031507 Bacteria 1556
52 Ga0307408_100745955 3300031548 Bacteria 884
53 Ga0307405_11449141 3300031731 Unclassified 602
54 Ga0307518_10222605 3300031838 Bacteria 1230
55 Ga0307410_10020454 3300031852 Bacteria 4049
56 Ga0307406_11041971 3300031901 Bacteria 704
57 Ga0307407_10781863 3300031903 Bacteria 725
58 Ga0307409_100084299 3300031995 Bacteria 2580
59 Ga0307409_100742139 3300031995 Bacteria 985
60 Ga0307416_100244319 3300032002 Bacteria 1742
61 Ga0307416_101148422 3300032002 Bacteria 882
62 Ga0307416_101709510 3300032002 Unclassified 734
63 Ga0307414_10210427 3300032004 Bacteria 1589
64 Ga0307414_11439720 3300032004 Bacteria 641
65 Ga0307507_10028111 3300033179 Bacteria 6002
66 Ga0307507_10064880 3300033179 Bacteria 3364
67 Ga0307507_10096178 3300033179 Bacteria 2507
68 Ga0373956_0000037 3300035119 Bacteria 43249
69 Ga0436363_0772062 3300039450 Bacteria 1000
70 Ga0451789_0672380 3300041443 Bacteria 1798
71 Ga0451791_0009612 3300041451 Bacteria 4929
72 Ga0451855_0309412 3300041511 Bacteria 677
73 Ga0466969_0011034 3300044656 Bacteria 4784
74 Ga0466969_0130481 3300044656 Bacteria 1165
75 Ga0466972_0002394 3300044658 Bacteria 9247
76 Ga0466972_0002470 3300044658 Bacteria 9146
77 Ga0466965_0008790 3300044683 Bacteria 4681
78 Ga0466965_0011682 3300044683 Bacteria 4118
79 Ga0466965_0022330 3300044683 Bacteria 3051
80 Ga0466965_0069302 3300044683 Bacteria 1772
81 Ga0466966_0003587 3300044684 Bacteria 10245
82 Ga0466966_0021407 3300044684 Bacteria 4245
83 Ga0466961_0005604 3300044693 Bacteria 7932
84 Ga0466961_0092301 3300044693 Bacteria 1911
85 Ga0466963_0000612 3300044694 Bacteria 17109
86 Ga0466963_0180715 3300044694 Bacteria 1473
87 Ga0466963_0210550 3300044694 Bacteria 1360
88 Ga0466964_0115276 3300044706 Bacteria 1204
89 Ga0466971_0001077 3300044719 Bacteria 11342
90 Ga0466971_0044499 3300044719 Bacteria 1993
91 Ga0466971_0088842 3300044719 Bacteria 1414
92 Ga0466968_0011185 3300044735 Bacteria 3496
93 Ga0466968_0073091 3300044735 Bacteria 1496
94 Ga0466970_0013490 3300044765 Bacteria 4190
95 Ga0466970_0020177 3300044765 Bacteria 3460
96 Ga0466957_0000796 3300044842 Bacteria 16100
97 Ga0466960_0002749 3300044901 Bacteria 6658
98 Ga0466960_0004364 3300044901 Bacteria 5522
99 Ga0466959_0000403 3300045049 Bacteria 25325
100 Ga0466959_0011353 3300045049 Bacteria 6399
101 Ga0466958_0000831 3300045836 Bacteria 13639
102 Ga0466958_0360456 3300045836 Bacteria 936
103 Ga0466967_0006599 3300045976 Bacteria 8241
104 Ga0466967_0012371 3300045976 Bacteria 6523
105 Ga0466967_0082526 3300045976 Bacteria 2905
106 Ga0466967_0683539 3300045976 Bacteria 1016
107 Ga0496111_0194415 3300048914 Bacteria 1508
108 Ga0501318_074093 3300049534 Bacteria 542
109 Ga0501042_0738992 3300049578 Bacteria 716
110 Ga0501071_0819986 3300049587 Bacteria 717
111 nmdc:mga0qj67_591529_c1 3300050509 Bacteria 888
112 Ga0500644_0055231 3300053088 Bacteria 1378
113 Ga0500644_0069472 3300053088 Bacteria 1265
114 Ga0500616_0002112 3300053153 Bacteria 17263
115 Ga0466962_0001769 3300061719 Bacteria 10158
116 Ga0466962_0096692 3300061719 Bacteria 1416
117 Ga0466962_0130944 3300061719 Bacteria 1212
118 Ga0530510_0984033 3300061734 Bacteria 645
119 2776376927 2775506925 Bacteria 7237746
120 2558908239 2558860112 Bacteria 9931328
121 2795786608 2795385470 Bacteria 8317180
122 2863071878 2863067949 Bacteria 8541735
123 2866553625 2866552031 Bacteria 5824618
124 2899366716 2899359706 Bacteria 10940472
125 2899375556 2899370129 Bacteria 6781179
126 2920882458 2920879853 Bacteria 4216831
127 8003316917 8003314358 Bacteria 10575343
128 8047711900 8047710418 Bacteria 11023148
129 8054475442 8054472261 Bacteria 7464355
130 8056211479 8056207758 Bacteria 8639239
131 JGI25406J46586_10000865
132 JGI25406J46586_10031945
133 JGI25407J50210_10075971
134 Ga0070658_10098664
135 Ga0070659_100005467
136 Ga0070714_100001959
137 Ga0070710_10000295
138 Ga0070663_100350101
139 Ga0070698_100010407
140 Ga0070684_101031489
141 Ga0070684_101176781
142 Ga0070665_100394883
143 Ga0068861_100276953
144 Ga0081455_10000105
145 Ga0081455_10129736
146 Ga0081538_10000005
147 Ga0081539_10000100
148 Ga0081539_10000196
149 Ga0070717_10133433
150 Ga0075430_100525670
151 Ga0097620_101120640
152 Ga0111539_10664412
153 Ga0105237_10183501
154 Ga0105238_10057719
155 Ga0105249_11465339
156 Ga0157371_10027370
157 Ga0163163_11331888
158 Ga0157380_11987481
159 Ga0213874_10265934
160 Ga0207692_10000144
161 Ga0207705_10000947
162 Ga0207705_10137273
163 Ga0207660_10029828
164 Ga0207694_10035472
165 Ga0207664_10005563
166 Ga0207664_10024856
167 Ga0207664_10086106
168 Ga0207690_10018007
169 Ga0207690_10957106
170 Ga0207669_10254257
171 Ga0207667_10615650
172 Ga0207639_10052136
173 Ga0207678_10663184
174 Ga0307515_10045190
175 Ga0316177_1183956
176 Ga0316176_1031107
177 Ga0314311_1030145
178 Ga0316179_1012584
179 Ga0316180_1006041
180 Ga0307513_10006937
181 Ga0307509_10250326
182 Ga0307408_100745955
183 Ga0307405_11449141
184 Ga0307518_10222605
185 Ga0307410_10020454
186 Ga0307406_11041971
187 Ga0307407_10781863
188 Ga0307409_100084299
189 Ga0307409_100742139
190 Ga0307416_100244319
191 Ga0307416_101148422
192 Ga0307416_101709510
193 Ga0307414_10210427
194 Ga0307414_11439720
195 Ga0307507_10028111
196 Ga0307507_10064880
197 Ga0307507_10096178
198 Ga0373956_0000037
199 Ga0436363_0772062
200 Ga0451789_0672380
201 Ga0451791_0009612
202 Ga0451855_0309412
203 Ga0466969_0011034
204 Ga0466969_0130481
205 Ga0466972_0002394
206 Ga0466972_0002470
207 Ga0466965_0008790
208 Ga0466965_0011682
209 Ga0466965_0022330
210 Ga0466965_0069302
211 Ga0466966_0003587
212 Ga0466966_0021407
213 Ga0466961_0005604
214 Ga0466961_0092301
215 Ga0466963_0000612
216 Ga0466963_0180715
217 Ga0466963_0210550
218 Ga0466964_0115276
219 Ga0466971_0001077
220 Ga0466971_0044499
221 Ga0466971_0088842
222 Ga0466968_0011185
223 Ga0466968_0073091
224 Ga0466970_0013490
225 Ga0466970_0020177
226 Ga0466957_0000796
227 Ga0466960_0002749
228 Ga0466960_0004364
229 Ga0466959_0000403
230 Ga0466959_0011353
231 Ga0466958_0000831
232 Ga0466958_0360456
233 Ga0466967_0006599
234 Ga0466967_0012371
235 Ga0466967_0082526
236 Ga0466967_0683539
237 Ga0496111_0194415
238 Ga0501318_074093
239 Ga0501042_0738992
240 Ga0501071_0819986
241 nmdc:mga0qj67_591529_c1
242 Ga0500644_0055231
243 Ga0500644_0069472
244 Ga0500616_0002112
245 Ga0466962_0001769
246 Ga0466962_0096692
247 Ga0466962_0130944
248 Ga0530510_0984033
249 2776376927
250 2558908239
251 2795786608
252 2863071878
253 2866553625
254 2899366716
255 2899375556
256 2920882458
257 8003316917
258 8047711900
259 8054475442
260 8056211479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

40

172

0.96

PF22769

DCD

dCTP deaminase-like

51

147

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okb-assembly1.cif.gz_A high resolution crystal structures of vaccinia virus dutpase 0.9381 7 123
2okb-assembly1.cif.gz_A high resolution crystal structures of vaccinia virus dutpase 0.9302 7 123
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9092 3 130
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.9083 3 130
1sm8-assembly1.cif.gz_C m. tuberculosis dutpase complexed with chromium and dutp 0.9036 3 130
ID Description Score Start End Superfamily
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.902 3 130 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8887 3 130 2.70.40.10
5y5qC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8826 3 123 2.70.40.10
2d4lA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8769 18 120 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8666 5 133 2.70.40.10
ID Description Score Start End GO Terms
AF-X0ZBN9-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.944 1 122 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-X1TBK2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9435 3 123 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-X0ZBN9-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9366 1 122 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A7V9BGE2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9331 9 122 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-X1TBK2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9285 3 123 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map