F147176

General Info

Members Datasets Scaffolds Average Seq Length
130 69 260 247

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_311143_c1|nmdc:mga06r32_311143_c1_328_1152
Length 274
Sequence VDVFKSQQKTLEVVIDFRSLFTGKINSMKEYIYSRNAVYETLRAKRRDIFKIELADNVQIKGRLAEIMALAQHRKIQVVKAPRASVDKVHEHSQGIVAEVGKYPYVDLLDILENARKKNEPPFVLLLDSLNDPQNFGTLIRTAEATGVHGVIIPLAHTVEVTPSVVNASSGASEHMLIAQSNLAQAIDALKEENVWIVGLDQNGEVVGAKTQRHLTGATGLVVGSEGEGIRQLTRAKCDIVLKLPMRGQVESLNAAVAGSVALYMAYMARQETR

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
61 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
62 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
65 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
66 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
67 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
68 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
69 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 23.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_311143_c1 3300050510 Bacteria 1561
2 SwRhRL2b_contig_901950 2162886007 Bacteria 5513
3 JGI25406J46586_10002455 3300003203 Bacteria 8765
4 Ga0065704_10070812 3300005289 Bacteria 15813
5 Ga0065707_10000483 3300005295 Bacteria 53504
6 Ga0065707_10083786 3300005295 Bacteria 8241
7 Ga0065707_10087403 3300005295 Bacteria 5037
8 Ga0065707_10124368 3300005295 Bacteria 2045
9 Ga0070675_100678864 3300005354 Bacteria 937
10 Ga0070705_100249184 3300005440 Unclassified 1246
11 Ga0070706_100259191 3300005467 Unclassified 1623
12 Ga0070707_100491364 3300005468 Unclassified 1189
13 Ga0070698_100247504 3300005471 Bacteria 1715
14 Ga0070698_100507231 3300005471 Unclassified 1144
15 Ga0070699_100001659 3300005518 Bacteria 20325
16 Ga0070699_100197175 3300005518 Bacteria 1790
17 Ga0070699_100287133 3300005518 Unclassified 1474
18 Ga0070696_100156218 3300005546 Bacteria 1678
19 Ga0070704_100152405 3300005549 Bacteria 1819
20 Ga0070704_100396041 3300005549 Bacteria 1177
21 Ga0070704_100455200 3300005549 Bacteria 1103
22 Ga0070704_100809330 3300005549 Unclassified 838
23 Ga0070702_100103049 3300005615 Bacteria 1754
24 Ga0068861_100340966 3300005719 Bacteria 1311
25 Ga0068862_100479248 3300005844 Bacteria 1177
26 Ga0068862_100537058 3300005844 Bacteria 1115
27 Ga0068862_100647463 3300005844 Bacteria 1019
28 Ga0075427_10023673 3300006194 Bacteria 985
29 Ga0075428_100467906 3300006844 Bacteria 1350
30 Ga0075428_100634006 3300006844 Bacteria 1140
31 Ga0075431_100123964 3300006847 Bacteria 2666
32 Ga0075431_100248995 3300006847 Bacteria 1806
33 Ga0075431_100392960 3300006847 Bacteria 1389
34 Ga0075433_10124262 3300006852 Bacteria 2292
35 Ga0075434_100875528 3300006871 Unclassified 913
36 Ga0075429_100025078 3300006880 Bacteria 5177
37 Ga0075429_100049156 3300006880 Unclassified 3667
38 Ga0075429_100089564 3300006880 Bacteria 2682
39 Ga0075429_100100143 3300006880 Bacteria 2529
40 Ga0111539_10010405 3300009094 Bacteria 11712
41 Ga0114129_10000806 3300009147 Bacteria 40261
42 Ga0114129_10088616 3300009147 Bacteria 4290
43 Ga0114129_10092121 3300009147 Unclassified 4199
44 Ga0114129_10119253 3300009147 Bacteria 3634
45 Ga0114129_10332853 3300009147 Bacteria 2015
46 Ga0114129_11608147 3300009147 Bacteria 795
47 Ga0105243_10129320 3300009148 Bacteria 2140
48 Ga0105243_10413510 3300009148 Bacteria 1256
49 Ga0105242_10094641 3300009176 Bacteria 2520
50 Ga0105246_10112440 3300011119 Unclassified 2003
51 Ga0105246_10498417 3300011119 Bacteria 1034
52 Ga0105246_10634348 3300011119 Bacteria 928
53 Ga0157380_10174044 3300014326 Bacteria 1884
54 Ga0207684_10208971 3300025910 Unclassified 1684
55 Ga0207684_10323937 3300025910 Bacteria 1328
56 Ga0207646_10067788 3300025922 Bacteria 3186
57 Ga0207646_10688333 3300025922 Unclassified 915
58 Ga0207686_10057645 3300025934 Bacteria 2446
59 Ga0207709_10429263 3300025935 Bacteria 1017
60 Ga0207670_10046002 3300025936 Bacteria 2897
61 Ga0207674_10052400 3300026116 Bacteria 4162
62 Ga0207675_100019143 3300026118 Bacteria 6390
63 Ga0209999_1022991 3300027543 Bacteria 1148
64 Ga0268265_10420161 3300028380 Bacteria 1241
65 Ga0268265_10639841 3300028380 Bacteria 1021
66 Ga0265318_10044881 3300028577 Bacteria 1672
67 Ga0265323_10059041 3300028653 Unclassified 1338
68 Ga0265338_10044284 3300028800 Bacteria 4112
69 Ga0265330_10049704 3300031235 Bacteria 1840
70 Ga0265332_10029588 3300031238 Bacteria 2394
71 Ga0265320_10198267 3300031240 Bacteria 897
72 Ga0316579_10089091 3300031691 Unclassified 1473
73 Ga0316578_10119770 3300031728 Bacteria 1582
74 Ga0307407_10026214 3300031903 Bacteria 3084
75 Ga0307416_100157129 3300032002 Unclassified 2095
76 Ga0307411_10297927 3300032005 Bacteria 1292
77 Ga0307415_100082139 3300032126 Unclassified 2304
78 Ga0316584_0096358 3300036712 Bacteria 2215
79 Ga0400487_06828 3300039110 Unclassified 1896
80 Ga0451577_0025641 3300042876 Bacteria 5348
81 Ga0451577_0123934 3300042876 Bacteria 2316
82 Ga0451577_0132274 3300042876 Unclassified 2239
83 Ga0451577_0141435 3300042876 Bacteria 2162
84 Ga0451577_0206418 3300042876 Bacteria 1774
85 Ga0451577_0513429 3300042876 Bacteria 1088
86 Ga0453683_0016243 3300044673 Unclassified 4808
87 Ga0453683_0042493 3300044673 Unclassified 2854
88 Ga0453683_0332411 3300044673 Bacteria 975
89 Ga0453683_0456846 3300044673 Unclassified 826
90 Ga0453684_0000128 3300044712 Bacteria 335864
91 Ga0453684_0000670 3300044712 Bacteria 122645
92 Ga0453684_0000726 3300044712 Bacteria 116252
93 Ga0453684_0002378 3300044712 Bacteria 45940
94 Ga0453684_0012516 3300044712 Bacteria 13970
95 Ga0453684_0015237 3300044712 Bacteria 12192
96 Ga0453684_0046507 3300044712 Bacteria 5770
97 Ga0453684_0150218 3300044712 Unclassified 2769
98 Ga0453684_0245093 3300044712 Unclassified 2061
99 Ga0453684_0255407 3300044712 Bacteria 2010
100 Ga0453684_0313401 3300044712 Bacteria 1779
101 Ga0453684_0468862 3300044712 Unclassified 1399
102 Ga0453684_0518721 3300044712 Bacteria 1317
103 Ga0453684_0619336 3300044712 Unclassified 1184
104 Ga0453684_0786790 3300044712 Unclassified 1027
105 Ga0451576_0000311 3300045051 Bacteria 117825
106 Ga0451576_0007770 3300045051 Bacteria 12724
107 Ga0451576_0049157 3300045051 Bacteria 4426
108 Ga0451576_0077225 3300045051 Bacteria 3466
109 Ga0451576_0127308 3300045051 Bacteria 2654
110 Ga0451576_0404933 3300045051 Bacteria 1430
111 Ga0501034_0737819 3300049571 Bacteria 881
112 Ga0501036_0668977 3300049572 Unclassified 859
113 Ga0501039_0302661 3300049575 Bacteria 1257
114 Ga0501047_0304801 3300049581 Bacteria 1435
115 Ga0501071_0239945 3300049587 Unclassified 1367
116 Ga0501075_0009807 3300049591 Bacteria 6712
117 Ga0501076_0009726 3300049592 Bacteria 7102
118 Ga0501080_0078909 3300049742 Bacteria 3061
119 Ga0501080_0319559 3300049742 Bacteria 1406
120 Ga0501081_0027038 3300049743 Bacteria 3872
121 nmdc:mga05p37_14778_c1 3300050507 Bacteria 9376
122 nmdc:mga05p37_23152_c1 3300050507 Bacteria 7537
123 nmdc:mga05p37_476_c1 3300050507 Bacteria 43712
124 nmdc:mga09592_130844_c1 3300050508 Bacteria 2159
125 nmdc:mga09592_220943_c1 3300050508 Unclassified 1641
126 nmdc:mga09592_284_c1 3300050508 Bacteria 36913
127 nmdc:mga0qj67_135138_c1 3300050509 Bacteria 1998
128 nmdc:mga06r32_566463_c1 3300050510 Unclassified 1109
129 nmdc:mga08y16_17857_c1 3300050511 Bacteria 7472
130 nmdc:mga0a205_120958_c1 3300050515 Bacteria 2517
131 nmdc:mga06r32_311143_c1
132 SwRhRL2b_contig_901950
133 JGI25406J46586_10002455
134 Ga0065704_10070812
135 Ga0065707_10000483
136 Ga0065707_10083786
137 Ga0065707_10087403
138 Ga0065707_10124368
139 Ga0070675_100678864
140 Ga0070705_100249184
141 Ga0070706_100259191
142 Ga0070707_100491364
143 Ga0070698_100247504
144 Ga0070698_100507231
145 Ga0070699_100001659
146 Ga0070699_100197175
147 Ga0070699_100287133
148 Ga0070696_100156218
149 Ga0070704_100152405
150 Ga0070704_100396041
151 Ga0070704_100455200
152 Ga0070704_100809330
153 Ga0070702_100103049
154 Ga0068861_100340966
155 Ga0068862_100479248
156 Ga0068862_100537058
157 Ga0068862_100647463
158 Ga0075427_10023673
159 Ga0075428_100467906
160 Ga0075428_100634006
161 Ga0075431_100123964
162 Ga0075431_100248995
163 Ga0075431_100392960
164 Ga0075433_10124262
165 Ga0075434_100875528
166 Ga0075429_100025078
167 Ga0075429_100049156
168 Ga0075429_100089564
169 Ga0075429_100100143
170 Ga0111539_10010405
171 Ga0114129_10000806
172 Ga0114129_10088616
173 Ga0114129_10092121
174 Ga0114129_10119253
175 Ga0114129_10332853
176 Ga0114129_11608147
177 Ga0105243_10129320
178 Ga0105243_10413510
179 Ga0105242_10094641
180 Ga0105246_10112440
181 Ga0105246_10498417
182 Ga0105246_10634348
183 Ga0157380_10174044
184 Ga0207684_10208971
185 Ga0207684_10323937
186 Ga0207646_10067788
187 Ga0207646_10688333
188 Ga0207686_10057645
189 Ga0207709_10429263
190 Ga0207670_10046002
191 Ga0207674_10052400
192 Ga0207675_100019143
193 Ga0209999_1022991
194 Ga0268265_10420161
195 Ga0268265_10639841
196 Ga0265318_10044881
197 Ga0265323_10059041
198 Ga0265338_10044284
199 Ga0265330_10049704
200 Ga0265332_10029588
201 Ga0265320_10198267
202 Ga0316579_10089091
203 Ga0316578_10119770
204 Ga0307407_10026214
205 Ga0307416_100157129
206 Ga0307411_10297927
207 Ga0307415_100082139
208 Ga0316584_0096358
209 Ga0400487_06828
210 Ga0451577_0025641
211 Ga0451577_0123934
212 Ga0451577_0132274
213 Ga0451577_0141435
214 Ga0451577_0206418
215 Ga0451577_0513429
216 Ga0453683_0016243
217 Ga0453683_0042493
218 Ga0453683_0332411
219 Ga0453683_0456846
220 Ga0453684_0000128
221 Ga0453684_0000670
222 Ga0453684_0000726
223 Ga0453684_0002378
224 Ga0453684_0012516
225 Ga0453684_0015237
226 Ga0453684_0046507
227 Ga0453684_0150218
228 Ga0453684_0245093
229 Ga0453684_0255407
230 Ga0453684_0313401
231 Ga0453684_0468862
232 Ga0453684_0518721
233 Ga0453684_0619336
234 Ga0453684_0786790
235 Ga0451576_0000311
236 Ga0451576_0007770
237 Ga0451576_0049157
238 Ga0451576_0077225
239 Ga0451576_0127308
240 Ga0451576_0404933
241 Ga0501034_0737819
242 Ga0501036_0668977
243 Ga0501039_0302661
244 Ga0501047_0304801
245 Ga0501071_0239945
246 Ga0501075_0009807
247 Ga0501076_0009726
248 Ga0501080_0078909
249 Ga0501080_0319559
250 Ga0501081_0027038
251 nmdc:mga05p37_14778_c1
252 nmdc:mga05p37_23152_c1
253 nmdc:mga05p37_476_c1
254 nmdc:mga09592_130844_c1
255 nmdc:mga09592_220943_c1
256 nmdc:mga09592_284_c1
257 nmdc:mga0qj67_135138_c1
258 nmdc:mga06r32_566463_c1
259 nmdc:mga08y16_17857_c1
260 nmdc:mga0a205_120958_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

31

106

0.95

PF00588

SpoU_methylase

SpoU rRNA Methylase family

122

264

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9186 77 243
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9134 77 243
3nk6-assembly1.cif.gz_A structure of the nosiheptide-resistance methyltransferase 0.8718 2 242
3nk7-assembly1.cif.gz_A structure of the nosiheptide-resistance methyltransferase s-adenosyl-l-methionine complex 0.8702 2 241
1x7o-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes 0.8568 2 242
ID Description Score Start End Superfamily
af_D3ZK81_42_122_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9576 2 74 3.30.1330.30
af_Q2G2M3_1_72_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9275 4 71 3.30.1330.30
af_I1KPW8_257_343_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9237 3 74 3.30.1330.30
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9221 79 243 3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9166 84 243 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A7C3AJ79-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9707 1 242 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A6B3H158-F1-model_v4 RNA methyltransferase 0.9641 79 227 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7C3AJ79-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9628 1 242 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A1H8A9I6-F1-model_v4 23S rRNA (Guanosine2251-2'-O)-methyltransferase 0.9606 2 242 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-R6G5D0-F1-model_v4 deleted 0.9568 3 242

Map