F143352

General Info

Members Datasets Scaffolds Average Seq Length
129 102 258 235

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0083968|Ga0501035_0083968_1968_2747
Length 259
Sequence MFASITKKHAQARNMIFPQIANHAHSHAMKVIRKSNERGHAQHGWLDSYHTFSFADYYDPKWIHFRTLRVINDDLIMPGMGFGTHPHRDMEIISYVLAGELQHRDSMGNGRVIKPGEFQYMAAGSGVQHSEFNPSKTEATRLLQIWIMPDEKGVKPRYAERNFTKAETGKLHLVASKSGRDGSMEIHQDADLLLGKLEPGQSVNHALAKDRHAWIHVAEGEVKINGTTLSGGDAIALTDEANVEIAATKPSQVLLFDLN

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
29 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
57 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
58 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
59 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
60 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
61 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
62 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
63 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 0.78
Rhizosphere 95.35
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0083968 3300049822 Bacteria 2809
2 rootH2_10027074 3300003320 Bacteria 6700
3 rootH2_10057889 3300003320 Bacteria 1235
4 Ga0065707_10096825 3300005295 Bacteria 3230
5 Ga0070689_100075779 3300005340 Bacteria 2634
6 Ga0070688_100022384 3300005365 Bacteria 3703
7 Ga0070709_10250695 3300005434 Bacteria 1275
8 Ga0070681_10041792 3300005458 Bacteria 4595
9 Ga0070679_100000292 3300005530 Bacteria 42564
10 Ga0070679_100066054 3300005530 Unclassified 3606
11 Ga0070695_100327957 3300005545 Bacteria 1140
12 Ga0068855_100005496 3300005563 Bacteria 15463
13 Ga0068855_100088512 3300005563 Bacteria 3576
14 Ga0068856_100000211 3300005614 Bacteria 63015
15 Ga0068860_100567357 3300005843 Bacteria 1138
16 Ga0081455_10205215 3300005937 Bacteria 1472
17 Ga0097621_100228982 3300006237 Bacteria 1622
18 Ga0075430_100013588 3300006846 Bacteria 6938
19 Ga0075429_100428827 3300006880 Bacteria 1158
20 Ga0105240_10249169 3300009093 Unclassified 2055
21 Ga0111539_10063894 3300009094 Bacteria 4356
22 Ga0105247_10024321 3300009101 Bacteria 3649
23 Ga0105242_10081555 3300009176 Bacteria 2705
24 Ga0105237_10002818 3300009545 Bacteria 21133
25 Ga0105237_10023464 3300009545 Bacteria 6321
26 Ga0157370_10288807 3300013104 Bacteria 1515
27 Ga0163162_10270074 3300013306 Bacteria 1832
28 Ga0157372_11354969 3300013307 Bacteria 821
29 Ga0163163_10000147 3300014325 Bacteria 73154
30 Ga0157380_10002074 3300014326 Bacteria 13435
31 Ga0157379_10274999 3300014968 Bacteria 1532
32 Ga0209233_1007862 3300025261 Bacteria 3344
33 Ga0207710_10030123 3300025900 Bacteria 2365
34 Ga0207688_10009946 3300025901 Bacteria 5175
35 Ga0207705_10104882 3300025909 Bacteria 2083
36 Ga0207671_10006155 3300025914 Bacteria 10783
37 Ga0207671_10014117 3300025914 Bacteria 6327
38 Ga0207657_10245746 3300025919 Bacteria 1427
39 Ga0207652_10001774 3300025921 Bacteria 18784
40 Ga0207652_10202643 3300025921 Unclassified 1786
41 Ga0207700_10366582 3300025928 Bacteria 1257
42 Ga0207644_10156024 3300025931 Bacteria 1770
43 Ga0207690_10220546 3300025932 Bacteria 1451
44 Ga0207670_10003223 3300025936 Bacteria 8648
45 Ga0207667_10054738 3300025949 Bacteria 4196
46 Ga0207703_10092696 3300026035 Bacteria 2543
47 Ga0207708_10189546 3300026075 Bacteria 1636
48 Ga0207702_10001647 3300026078 Bacteria 22041
49 Ga0207702_10004103 3300026078 Bacteria 13064
50 Ga0207702_10006584 3300026078 Bacteria 9986
51 Ga0207702_10238146 3300026078 Bacteria 1704
52 Ga0207641_10018940 3300026088 Bacteria 5647
53 Ga0207641_10209024 3300026088 Bacteria 1804
54 Ga0207675_100015448 3300026118 Bacteria 7121
55 Ga0207428_10227556 3300027907 Bacteria 1396
56 Ga0268264_10000747 3300028381 Bacteria 36690
57 Ga0265338_10046022 3300028800 Bacteria 4004
58 Ga0265338_10058119 3300028800 Bacteria 3417
59 Ga0265324_10000319 3300029957 Bacteria 35387
60 Ga0265324_10009562 3300029957 Bacteria 3778
61 Ga0265324_10017545 3300029957 Bacteria 2603
62 Ga0265324_10019188 3300029957 Bacteria 2465
63 Ga0265324_10091033 3300029957 Bacteria 1037
64 Ga0265324_10110349 3300029957 Bacteria 934
65 Ga0265328_10037955 3300031239 Bacteria 1779
66 Ga0265328_10039332 3300031239 Bacteria 1745
67 Ga0265320_10097755 3300031240 Bacteria 1354
68 Ga0265340_10048217 3300031247 Bacteria 2072
69 Ga0265327_10002598 3300031251 Bacteria 18692
70 Ga0265327_10009825 3300031251 Bacteria 6837
71 Ga0265316_10122319 3300031344 Bacteria 1965
72 Ga0265313_10052767 3300031595 Bacteria 1939
73 Ga0265314_10189948 3300031711 Bacteria 1223
74 Ga0373930_0000545 3300034816 Bacteria 5177
75 Ga0373944_0007475 3300035089 Bacteria 2932
76 Ga0373951_0004429 3300035091 Bacteria 3338
77 Ga0373932_0000001 3300035112 Bacteria 1459067
78 Ga0373939_0068267 3300035114 Bacteria 1151
79 Ga0373945_0001752 3300035116 Bacteria 6703
80 Ga0373943_0333038 3300035170 Bacteria 867
81 Ga0373962_0000103 3300035242 Bacteria 18672
82 Ga0373931_0000008 3300035691 Bacteria 362269
83 Ga0373935_0146132 3300035692 Bacteria 1601
84 Ga0373927_0006207 3300035695 Bacteria 8160
85 Ga0373927_0010657 3300035695 Bacteria 6123
86 Ga0373937_0395185 3300036401 Bacteria 1312
87 Ga0373925_0024516 3300037068 Bacteria 4404
88 Ga0395899_0000148 3300037312 Bacteria 106403
89 Ga0451577_0004341 3300042876 Bacteria 15032
90 Ga0453684_0297366 3300044712 Bacteria 1836
91 Ga0453684_0299524 3300044712 Unclassified 1828
92 Ga0453684_1088130 3300044712 Bacteria 845
93 Ga0466971_0000038 3300044719 Bacteria 52482
94 Ga0466957_0002533 3300044842 Bacteria 9833
95 Ga0451576_0037619 3300045051 Bacteria 5126
96 Ga0451576_0039830 3300045051 Bacteria 4975
97 Ga0451576_0048927 3300045051 Unclassified 4438
98 Ga0451576_0225260 3300045051 Bacteria 1958
99 Ga0495638_0258441 3300046460 Bacteria 956
100 Ga0495641_0065828 3300046461 Bacteria 1631
101 Ga0495664_0180830 3300046477 Bacteria 1279
102 Ga0495630_0000131 3300046517 Bacteria 59509
103 Ga0495643_0000412 3300046522 Bacteria 56093
104 Ga0495666_0029329 3300046526 Bacteria 2706
105 Ga0495586_0000031 3300046535 Bacteria 96104
106 Ga0495625_0368782 3300046660 Bacteria 903
107 Ga0495647_0039514 3300046681 Bacteria 1789
108 Ga0495613_0043363 3300046689 Bacteria 3328
109 Ga0495674_0000197 3300047319 Bacteria 48664
110 Ga0495676_0010252 3300047321 Bacteria 8503
111 Ga0496115_0005366 3300048918 Bacteria 9329
112 Ga0496118_0287052 3300048921 Bacteria 912
113 Ga0496121_0027355 3300048924 Bacteria 5338
114 Ga0501031_0000113 3300049568 Bacteria 43219
115 Ga0501032_0056556 3300049569 Bacteria 2637
116 Ga0501032_0081594 3300049569 Bacteria 2152
117 Ga0501033_0045723 3300049570 Bacteria 3257
118 Ga0501034_0084789 3300049571 Bacteria 3170
119 Ga0501036_0669112 3300049572 Bacteria 859
120 Ga0501038_0001211 3300049574 Bacteria 23367
121 Ga0501043_0450182 3300049579 Bacteria 967
122 Ga0501047_0341553 3300049581 Bacteria 1335
123 Ga0501044_0000792 3300049823 Bacteria 38210
124 Ga0501044_0154675 3300049823 Bacteria 2273
125 Ga0501044_0233018 3300049823 Bacteria 1788
126 nmdc:mga0qj67_9477_c1 3300050509 Bacteria 7248
127 nmdc:mga08y16_12566_c1 3300050511 Bacteria 8909
128 nmdc:mga08x19_269821_c1 3300050514 Unclassified 1177
129 Ga0466962_0000011 3300061719 Bacteria 129727
130 Ga0501035_0083968
131 rootH2_10027074
132 rootH2_10057889
133 Ga0065707_10096825
134 Ga0070689_100075779
135 Ga0070688_100022384
136 Ga0070709_10250695
137 Ga0070681_10041792
138 Ga0070679_100000292
139 Ga0070679_100066054
140 Ga0070695_100327957
141 Ga0068855_100005496
142 Ga0068855_100088512
143 Ga0068856_100000211
144 Ga0068860_100567357
145 Ga0081455_10205215
146 Ga0097621_100228982
147 Ga0075430_100013588
148 Ga0075429_100428827
149 Ga0105240_10249169
150 Ga0111539_10063894
151 Ga0105247_10024321
152 Ga0105242_10081555
153 Ga0105237_10002818
154 Ga0105237_10023464
155 Ga0157370_10288807
156 Ga0163162_10270074
157 Ga0157372_11354969
158 Ga0163163_10000147
159 Ga0157380_10002074
160 Ga0157379_10274999
161 Ga0209233_1007862
162 Ga0207710_10030123
163 Ga0207688_10009946
164 Ga0207705_10104882
165 Ga0207671_10006155
166 Ga0207671_10014117
167 Ga0207657_10245746
168 Ga0207652_10001774
169 Ga0207652_10202643
170 Ga0207700_10366582
171 Ga0207644_10156024
172 Ga0207690_10220546
173 Ga0207670_10003223
174 Ga0207667_10054738
175 Ga0207703_10092696
176 Ga0207708_10189546
177 Ga0207702_10001647
178 Ga0207702_10004103
179 Ga0207702_10006584
180 Ga0207702_10238146
181 Ga0207641_10018940
182 Ga0207641_10209024
183 Ga0207675_100015448
184 Ga0207428_10227556
185 Ga0268264_10000747
186 Ga0265338_10046022
187 Ga0265338_10058119
188 Ga0265324_10000319
189 Ga0265324_10009562
190 Ga0265324_10017545
191 Ga0265324_10019188
192 Ga0265324_10091033
193 Ga0265324_10110349
194 Ga0265328_10037955
195 Ga0265328_10039332
196 Ga0265320_10097755
197 Ga0265340_10048217
198 Ga0265327_10002598
199 Ga0265327_10009825
200 Ga0265316_10122319
201 Ga0265313_10052767
202 Ga0265314_10189948
203 Ga0373930_0000545
204 Ga0373944_0007475
205 Ga0373951_0004429
206 Ga0373932_0000001
207 Ga0373939_0068267
208 Ga0373945_0001752
209 Ga0373943_0333038
210 Ga0373962_0000103
211 Ga0373931_0000008
212 Ga0373935_0146132
213 Ga0373927_0006207
214 Ga0373927_0010657
215 Ga0373937_0395185
216 Ga0373925_0024516
217 Ga0395899_0000148
218 Ga0451577_0004341
219 Ga0453684_0297366
220 Ga0453684_0299524
221 Ga0453684_1088130
222 Ga0466971_0000038
223 Ga0466957_0002533
224 Ga0451576_0037619
225 Ga0451576_0039830
226 Ga0451576_0048927
227 Ga0451576_0225260
228 Ga0495638_0258441
229 Ga0495641_0065828
230 Ga0495664_0180830
231 Ga0495630_0000131
232 Ga0495643_0000412
233 Ga0495666_0029329
234 Ga0495586_0000031
235 Ga0495625_0368782
236 Ga0495647_0039514
237 Ga0495613_0043363
238 Ga0495674_0000197
239 Ga0495676_0010252
240 Ga0496115_0005366
241 Ga0496118_0287052
242 Ga0496121_0027355
243 Ga0501031_0000113
244 Ga0501032_0056556
245 Ga0501032_0081594
246 Ga0501033_0045723
247 Ga0501034_0084789
248 Ga0501036_0669112
249 Ga0501038_0001211
250 Ga0501043_0450182
251 Ga0501047_0341553
252 Ga0501044_0000792
253 Ga0501044_0154675
254 Ga0501044_0233018
255 nmdc:mga0qj67_9477_c1
256 nmdc:mga08y16_12566_c1
257 nmdc:mga08x19_269821_c1
258 Ga0466962_0000011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

173

258

0.99

PF02678

Pirin

Pirin

31

147

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9723 15 245
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9686 15 244
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9522 15 244
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9479 15 245
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.8666 21 135
ID Description Score Start End Superfamily
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9785 25 148 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9694 27 145 2.60.120.10
af_P46852_133_231_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9652 153 244 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9626 25 148 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9538 27 145 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3C1VJM7-F1-model_v4 Quercetin 2,3-dioxygenase 0.9949 68 245 GO:0046872
GO:0051213
AF-A0A534X9Y4-F1-model_v4 Pirin family protein 0.991 19 133
AF-F4HAY5-F1-model_v4 Pirin N-terminal domain-containing protein 0.9901 19 132
AF-A0A2D0J2C0-F1-model_v4 Quercetin 2,3-dioxygenase 0.9895 19 134 GO:0051213
AF-A0A3C1VJM7-F1-model_v4 Quercetin 2,3-dioxygenase 0.9894 68 245 GO:0046872
GO:0051213

Map