F142965

General Info

Members Datasets Scaffolds Average Seq Length
129 67 258 231

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0180394|Ga0495630_0180394_787_1524
Length 245
Sequence MSTLTEGDADAGMPLLRVRGLTKVYHLGEDFWALRGVDIDINEGELVSIVGQSGSGKSTLLNILGCLDRPTGGDYWLAGHHINKMSSNELAAVRNQFLGFVFQSFHLLPRLTALENVMLPLGYDHLQKHPDMREAAIASLRRVGLGDKLNNKPTQMSGGQQQRVAVARALVNKPSLLMADEPTGNLDSNTAHDILALFKDLHRQGTTVLIISHDPDIAASTDRKIEIKDGRIIGDTKIEHAGAAA

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
3 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
4 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
5 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
6 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
7 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
8 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
9 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
10 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
11 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
12 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
13 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
14 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
15 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
16 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
17 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
18 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
19 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
20 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
21 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
22 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
23 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
24 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
26 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
27 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
28 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
29 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
30 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
31 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
32 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
33 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
34 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
35 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
36 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
37 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
38 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
39 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
45 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
46 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
47 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
48 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
49 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
50 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
51 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
52 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
53 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
54 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
55 2860837431 Bacillus sp. WR11 Isolate Unclassified
56 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
57 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
58 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
59 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
60 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
61 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
62 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
63 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
64 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
65 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
66 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
67 8022653035 Bacillus sp. Rc4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.82
Metatranscriptomes 0.78
Isolates 12.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 1.55
Rhizoplane 0
Rhizosphere 75.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0180394 3300046517 Bacteria 1610
2 Ga0068855_100121691 3300005563 Bacteria 2986
3 Ga0068857_100032905 3300005577 Bacteria 4584
4 Ga0105241_10060220 3300009174 Bacteria 2920
5 Ga0105239_10023361 3300010375 Bacteria 6809
6 Ga0157370_10182099 3300013104 Bacteria 1952
7 Ga0213876_10206832 3300021384 Bacteria 1043
8 Ga0207667_10365432 3300025949 Bacteria 1471
9 Ga0207674_10011826 3300026116 Bacteria 9786
10 Ga0265326_10009644 3300028558 Bacteria 2888
11 Ga0265318_10020891 3300028577 Bacteria 2635
12 Ga0265323_10002336 3300028653 Bacteria 8767
13 Ga0265336_10000773 3300028666 Bacteria 16946
14 Ga0265338_10000090 3300028800 Bacteria 171540
15 Ga0265327_10019219 3300031251 Bacteria 4208
16 Ga0316575_10029283 3300031665 Bacteria 2150
17 Ga0316575_10029528 3300031665 Bacteria 2141
18 Ga0316575_10068673 3300031665 Bacteria 1422
19 Ga0316575_10073637 3300031665 Bacteria 1374
20 Ga0316579_10025813 3300031691 Bacteria 2655
21 Ga0316576_10003471 3300031727 Bacteria 9246
22 Ga0316576_10006072 3300031727 Bacteria 7472
23 Ga0316576_10008695 3300031727 Bacteria 6499
24 Ga0316576_10016425 3300031727 Bacteria 4999
25 Ga0316576_10028167 3300031727 Bacteria 3957
26 Ga0316576_10028802 3300031727 Bacteria 3919
27 Ga0316576_10038387 3300031727 Bacteria 3433
28 Ga0316576_10070322 3300031727 Bacteria 2581
29 Ga0316576_10146781 3300031727 Bacteria 1777
30 Ga0316576_10185043 3300031727 Bacteria 1571
31 Ga0316576_10220886 3300031727 Bacteria 1425
32 Ga0316576_10232187 3300031727 Bacteria 1387
33 Ga0316578_10000433 3300031728 Bacteria 13818
34 Ga0316578_10057126 3300031728 Bacteria 2292
35 Ga0316578_10070386 3300031728 Bacteria 2070
36 Ga0316578_10138176 3300031728 Bacteria 1467
37 Ga0316578_10159194 3300031728 Bacteria 1361
38 Ga0316578_10260748 3300031728 Bacteria 1039
39 Ga0316577_10002067 3300031733 Bacteria 9806
40 Ga0316577_10028767 3300031733 Bacteria 3101
41 Ga0316577_10063333 3300031733 Bacteria 2065
42 Ga0316577_10077976 3300031733 Bacteria 1850
43 Ga0316577_10080119 3300031733 Bacteria 1825
44 Ga0316577_10203988 3300031733 Bacteria 1117
45 Ga0316583_10001020 3300032133 Bacteria 9045
46 Ga0316583_10001391 3300032133 Bacteria 8042
47 Ga0316583_10018713 3300032133 Bacteria 2487
48 Ga0316583_10054402 3300032133 Bacteria 1407
49 Ga0316583_10070265 3300032133 Bacteria 1225
50 Ga0316583_10149071 3300032133 Bacteria 814
51 Ga0316585_10002377 3300032137 Bacteria 5070
52 Ga0316585_10034359 3300032137 Bacteria 1602
53 Ga0316580_10001176 3300032139 Bacteria 6652
54 Ga0316580_10023630 3300032139 Bacteria 1899
55 Ga0316580_10036923 3300032139 Bacteria 1511
56 Ga0316592_1070407 3300033524 Bacteria 790
57 Ga0316574_0048993 3300035398 Bacteria 2625
58 Ga0316574_0069042 3300035398 Bacteria 2229
59 Ga0316574_0102537 3300035398 Bacteria 1832
60 Ga0316574_0117569 3300035398 Bacteria 1706
61 Ga0316574_0118592 3300035398 Bacteria 1698
62 Ga0373937_0040372 3300036401 Bacteria 4254
63 Ga0316582_0027229 3300036647 Bacteria 3450
64 Ga0316582_0034827 3300036647 Bacteria 3103
65 Ga0316582_0051827 3300036647 Bacteria 2606
66 Ga0316582_0118807 3300036647 Bacteria 1767
67 Ga0316582_0123935 3300036647 Bacteria 1731
68 Ga0316582_0549644 3300036647 Bacteria 795
69 Ga0316584_0012825 3300036712 Bacteria 5917
70 Ga0316584_0015646 3300036712 Bacteria 5427
71 Ga0316584_0019191 3300036712 Bacteria 4940
72 Ga0316584_0065985 3300036712 Bacteria 2712
73 Ga0316584_0097866 3300036712 Bacteria 2197
74 Ga0316584_0159743 3300036712 Bacteria 1675
75 Ga0316584_0204539 3300036712 Bacteria 1455
76 Ga0316584_0315379 3300036712 Bacteria 1129
77 Ga0316584_0347643 3300036712 Bacteria 1065
78 Ga0316581_0044920 3300037588 Bacteria 1350
79 Ga0436364_0513355 3300037853 Bacteria 10321
80 Ga0400484_18523 3300038725 Bacteria 4705
81 Ga0400490_20164 3300038726 Bacteria 20003
82 Ga0400490_27087 3300038726 Bacteria 2615
83 Ga0400491_05104 3300038727 Bacteria 11249
84 Ga0400491_17452 3300038727 Bacteria 1709
85 Ga0400485_20505 3300038735 Bacteria 6730
86 Ga0400488_16850 3300038741 Bacteria 1229
87 Ga0400488_24293 3300038741 Bacteria 4232
88 Ga0400486_06443 3300038742 Bacteria 19261
89 Ga0400486_11945 3300038742 Bacteria 10293
90 Ga0400486_19257 3300038742 Bacteria 29301
91 Ga0400483_125496 3300039062 Bacteria 3668
92 Ga0400483_172005 3300039062 Bacteria 6820
93 Ga0400489_46018 3300039093 Bacteria 42470
94 Ga0400489_56483 3300039093 Bacteria 1214
95 Ga0400487_31736 3300039110 Bacteria 3637
96 Ga0400487_66339 3300039110 Bacteria 1759
97 Ga0436365_0784546 3300039437 Bacteria 1445
98 Ga0451577_0147841 3300042876 Bacteria 2113
99 Ga0453683_0068137 3300044673 Bacteria 2225
100 Ga0453684_0000860 3300044712 Bacteria 102244
101 Ga0453684_0004186 3300044712 Bacteria 31067
102 Ga0453684_0236603 3300044712 Bacteria 2105
103 Ga0453684_0483935 3300044712 Bacteria 1373
104 Ga0451576_0094708 3300045051 Bacteria 3106
105 Ga0451576_0194198 3300045051 Bacteria 2120
106 Ga0451576_0580121 3300045051 Bacteria 1178
107 Ga0495581_0209440 3300047315 Bacteria 1140
108 Ga0495680_0458034 3300047322 Bacteria 872
109 Ga0496121_0013426 3300048924 Bacteria 8802
110 Ga0496122_0039427 3300048925 Bacteria 3767
111 Ga0496125_0000477 3300048928 Bacteria 70913
112 Ga0496126_0073471 3300048929 Bacteria 3040
113 nmdc:mga0sz30_21656_c1 3300050516 Bacteria 1531
114 2540608243 2540341094 Bacteria 4061186
115 2808990442 2808606387 Bacteria 5697198
116 2809053370 2808606399 Bacteria 4021018
117 2860841034 2860837431 Bacteria 4202080
118 2874620058 2874612657 Bacteria 8252029
119 2874634366 2874628541 Bacteria 8630250
120 2897809296 2897803580 Bacteria 7000062
121 2919175148 2919171160 Bacteria 6499771
122 2962294269 2962290636 Bacteria 4072939
123 2969140243 2969136845 Bacteria 3923176
124 2969768983 2969765954 Bacteria 4216713
125 2969771311 2969770375 Bacteria 4271280
126 2980496029 2980492589 Bacteria 4072961
127 3006882768 3006879489 Bacteria 4064221
128 8005380115 8005376324 Bacteria 6590079
129 8022657057 8022653035 Bacteria 4035078
130 Ga0495630_0180394
131 Ga0068855_100121691
132 Ga0068857_100032905
133 Ga0105241_10060220
134 Ga0105239_10023361
135 Ga0157370_10182099
136 Ga0213876_10206832
137 Ga0207667_10365432
138 Ga0207674_10011826
139 Ga0265326_10009644
140 Ga0265318_10020891
141 Ga0265323_10002336
142 Ga0265336_10000773
143 Ga0265338_10000090
144 Ga0265327_10019219
145 Ga0316575_10029283
146 Ga0316575_10029528
147 Ga0316575_10068673
148 Ga0316575_10073637
149 Ga0316579_10025813
150 Ga0316576_10003471
151 Ga0316576_10006072
152 Ga0316576_10008695
153 Ga0316576_10016425
154 Ga0316576_10028167
155 Ga0316576_10028802
156 Ga0316576_10038387
157 Ga0316576_10070322
158 Ga0316576_10146781
159 Ga0316576_10185043
160 Ga0316576_10220886
161 Ga0316576_10232187
162 Ga0316578_10000433
163 Ga0316578_10057126
164 Ga0316578_10070386
165 Ga0316578_10138176
166 Ga0316578_10159194
167 Ga0316578_10260748
168 Ga0316577_10002067
169 Ga0316577_10028767
170 Ga0316577_10063333
171 Ga0316577_10077976
172 Ga0316577_10080119
173 Ga0316577_10203988
174 Ga0316583_10001020
175 Ga0316583_10001391
176 Ga0316583_10018713
177 Ga0316583_10054402
178 Ga0316583_10070265
179 Ga0316583_10149071
180 Ga0316585_10002377
181 Ga0316585_10034359
182 Ga0316580_10001176
183 Ga0316580_10023630
184 Ga0316580_10036923
185 Ga0316592_1070407
186 Ga0316574_0048993
187 Ga0316574_0069042
188 Ga0316574_0102537
189 Ga0316574_0117569
190 Ga0316574_0118592
191 Ga0373937_0040372
192 Ga0316582_0027229
193 Ga0316582_0034827
194 Ga0316582_0051827
195 Ga0316582_0118807
196 Ga0316582_0123935
197 Ga0316582_0549644
198 Ga0316584_0012825
199 Ga0316584_0015646
200 Ga0316584_0019191
201 Ga0316584_0065985
202 Ga0316584_0097866
203 Ga0316584_0159743
204 Ga0316584_0204539
205 Ga0316584_0315379
206 Ga0316584_0347643
207 Ga0316581_0044920
208 Ga0436364_0513355
209 Ga0400484_18523
210 Ga0400490_20164
211 Ga0400490_27087
212 Ga0400491_05104
213 Ga0400491_17452
214 Ga0400485_20505
215 Ga0400488_16850
216 Ga0400488_24293
217 Ga0400486_06443
218 Ga0400486_11945
219 Ga0400486_19257
220 Ga0400483_125496
221 Ga0400483_172005
222 Ga0400489_46018
223 Ga0400489_56483
224 Ga0400487_31736
225 Ga0400487_66339
226 Ga0436365_0784546
227 Ga0451577_0147841
228 Ga0453683_0068137
229 Ga0453684_0000860
230 Ga0453684_0004186
231 Ga0453684_0236603
232 Ga0453684_0483935
233 Ga0451576_0094708
234 Ga0451576_0194198
235 Ga0451576_0580121
236 Ga0495581_0209440
237 Ga0495680_0458034
238 Ga0496121_0013426
239 Ga0496122_0039427
240 Ga0496125_0000477
241 Ga0496126_0073471
242 nmdc:mga0sz30_21656_c1
243 2540608243
244 2808990442
245 2809053370
246 2860841034
247 2874620058
248 2874634366
249 2897809296
250 2919175148
251 2962294269
252 2969140243
253 2969768983
254 2969771311
255 2980496029
256 3006882768
257 8005380115
258 8022657057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

34

184

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9779 6 222
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9715 3 222
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9678 3 222
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.966 4 222
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9648 3 222
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9717 32 222 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9702 3 222 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.965 1 222 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9648 3 222 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9639 3 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N2M1U9-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9849 4 222 GO:0005524
GO:0016887
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.984 24 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A538RLX8-F1-model_v4 ABC transporter ATP-binding protein 0.9814 6 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1V4IVY5-F1-model_v4 Bacitracin export ATP-binding protein BceA 0.9797 4 222 GO:0005524
GO:0016887
AF-A0A089I4Y8-F1-model_v4 ABC transporter ATP-binding protein 0.9787 6 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map